Partiprogram

 PDF | TXT
PARTIPROGRAM INNEHÅLL 1. Grön ideologi – solidaritet i handling 3 2. Människan 4 2.1 Frihet, integritet och demokrati 4 2.2 Rättssäkerhet och trygghet 5 2.3 Barn 6 2.4 Skola 6 2.5 Högre utbildning och forskning 8 2.6 Kultur 9 2.7 Lika rättigheter 10 2.8 Äldre 11 3. Miljön 13 3.1 Naturens ramar 13 3.2 Biologisk mångfald 14 3.3 Klimat 15 3.4 Jordbruk, skogsbruk och fiske 16 3.5 Djur 17 4. Ekonomin 18 4.1 Ekonomins ramar 18 4.2 Ekonomisk utveckling 19 4.3 Näringsliv 20 4.4 Arbetsmarknad 21 4.5 Energi 21 4.6 Transporter 22 5. Välfärden 24 5.1 Livskvalitet 24 5.2 Landsbygden 25 5.3 Staden 26 5.4 Förorter och miljonprogram 26 5.5 Hälso- och sjukvård 27 5.6 Bostad 28 5.7 Ekonomisk trygghet 29 5.8 Välfärdens utformning 30 6. Världen 32 6.1 Internationellt samarbete 32 6.2 Europeiska unionen 32 6.3 Nordiskt samarbete 34 6.4 Fred och säkerhet 34 6.5 Global utveckling och rättvisa 35 6.6 Migration 36 .............................. ..¯ 2 ................................ ..............................................ô Miljöpartiet de gröna är en del av en global grön rörelse som strävar efter en värld där alla kan leva goda liv utan att försämra förutsättningarna för kommande generationer. Vi vill föra en politik där vi lever inom naturens ramar, med insikt om vårt djupa beroende av varandra. Vi vill vara en röst för dem som inte kan göra sina röster hörda. Denna gränslösa solidaritet kan uttryckas trefaldigt: A solidaritet med djur, natur och det ekologiska systemet A solidaritet med kommande generationer A solidaritet med världens alla människor. Engrön samhällsanalysbyggerpåenhelhetssyn –allthängerihopochärberoende avvarandra. Miljöpartietdegröna uppstodur rörelserför miljö, solidaritet,jämställdhet ochfred.Viär ett politisktalternativförallasomerkänner de utmaningar som mänskligheten stårinför och som vill möta dem medaktivpolitik somgör skillnad i människors vardag. Vi vill bryta ner alla diskriminerande och ohållbara maktstrukturer i samhället. Vi är ett feministiskt parti som arbetar målmedvetet för allas lika rätt och möjligheter att delta fullt ut i samhällsbygget. Varje människa har rätt att vara och växa till den individ som hen vill vara. Vi är övertygade om att olikheter berikar och att mångfald, jämlikhet och jämställdhet är grunder för ett rättvist samhälle. Tillsammans kan vi skapa framtidstro och livskvalitet. Världen och mänskligheten är mitt i en förändring. Många har redan börjat göra medvetna val för att leva solidariskt och miljövänligt. Människor, företag och organisationer lanserar idéer för en bättre värld. Politikens koppling till forskning är viktig och forskningens resultat bör tas tillvara för att utveckla lösningar på samhälls- och klimatutmaningar. Förändringar kräver engagemang men hela ansvaret kan inte ligga på enskilda individer. Samhället är något människor skapar tillsammans. Politiken är nyckeln till förändring och måste visa vägen till ett hållbart samhälle. Vi tror på mångfald, och det är en av den gröna rörelsens styrkor. Det finns många sätt att vara grön på. Vi förenas av den gemensamma uppgiften att forma vårt samhälle för en ny tid. Vi välkomnar alla som vill vara med i detta arbete. 3 ................. ..s Människan är en kreativ och empatisk varelse som vill och kan ta ansvar. Den fantastiska mångfalden i människors synsätt och idéer utgör en rikedom som driver utvecklingen framåt. Denna rikedom behöver frihet, demokrati och trygghet för att blomstra. Alla människor ska ha friheten att söka lycka, kunskap och förverkligande av den egna potentialen. Yttrandefriheten och den fria åsiktsbildningen är ovärderliga. Det goda samhället behöver byggas på en grund av mänskliga fri- och rättigheter. Våra gemensamma angelägenheter ska hanteras med öppenhet, respekt, fri debatt och demokratiska beslut. Historienvisarattmänniskanochmänskliga samhällenharvaritkapablatillbådegodaoch grymmahandlingar.Övergreppenharoftauppkommitipolitiskasystemsomförminskatellerställt människormotvarandra,gjortindividerofriaoch kvävtförmåganatttänkaochhandlasjälvständigt. Vi tror på en demokrati med aktiva och delaktiga medborgare. Vi vill ha ett samhälle där individen ges möjlighet att bidra efter förmåga till samhällets utveckling och där alla har lika rättigheter. Därför måste samhället också stå som garant för en trygg välfärd, där alla erbjuds nya chanser att växa och utvecklas genom livet. Det skapar förutsättningar för goda livsvillkor vilket bidrar till människors utveckling och välbefinnande. Samhället är till för alla och skapas av alla. ............................................ ........................W Den gröna rörelsen står för ett frihetligt perspektiv på politiken. Vi är övertygade om att yttrandefrihet, åsiktsfrihet och deltagande demokrati gör samhället bättre. Det är på ställen där människor och kulturer möts och blandas, där människor är fria att tänka och tycka efter eget huvud, och där tankar, visioner och olikheter respekteras som nya utvecklande idéer blomstrar. Människorsfrihetsutövandebegränsasdelsav naturensramarochdelsavandramänniskors frihetsutövande.Allamänniskorhardärföransvar förattintebegränsaellerinskränkaandrasfriheter. Allaskaåtnjutalikarättigheterochmöjligheter oavsettkön,etnicitet,religion,funktionsnedsättning, sexuellläggning,könsidentitet,könsuttryckeller ålder.Allaformeravdiskrimineringskamotverkas. Förstnärallamänniskorerkännsförvilkadeär,får rättattdefinierasigsjälvaochhartillgångtilllika rättigheterkanviuppnåvälfärdföralla.Religionkan helleraldrigvaraenursäktförattbegränsaandras friheterochrättigheter.Allaskaharättattutövasin tro,ellerattavståfrånreligionsutövning. I en väl fungerande demokrati har människor möjlighet att uttrycka sina åsikter. Miljöpartiet är ett decentralistiskt parti. Beslut ska fattas så nära de människor som berörs som möjligt. Att ha möjlighet att välja vilken pedagogik man vill ha i skolan eller att välja hur man vill bli omhändertagen som gammal är en del i att flytta beslut närmare människan. Vi vill stärka egenmakten och inflytandet över välfärden. 4 Demokrati betyder folkstyre. Alla bör få möjlighet att arbeta politiskt under någon del av livet. För att underlätta detta vill vi begränsa hur många gånger man kan ställa upp till omval till ett politiskt förtroendeuppdrag. Inom Miljöpartiet tillämpar vi en rotationsprincip. För att öka möjligheterna för dagens unga att engagera sig och påverka vårt framtida samhälle vill vi sänka rösträttsåldern till 16 år. Olika erfarenheter och bakgrunder är av största vikt för demokratin i alla sammanslutningar där beslut fattas och därför vill vi i alla samman- hang verka för jämställdhet och mångfald. En deltagande demokrati kräver lättillgänglig information, en levande politisk debatt och möjlighet för medborgare att lyssna på sammanträden och lämna egna förslag till politiska församlingar. Människor med funktionsnedsättningar ska ha samma möjlighet att delta i samhället som andra. Om en viss andel medborgare efterfrågar det ska folkomröstningar hållas i viktiga frågor. I en demokrati ska ingen födas till ett offentligt ämbete. Vi har därför svårt att se monarkins plats i ett modernt demokratiskt samhälle och anser att den på sikt bör avskaffas. Offentlighetsprincipen och meddelarfriheten måste värnas och stärkas. Vi vill ha en lagstiftning som skyddar så kallade whistleblowers och som gäller över hela arbetsmarknaden. Medborgarna ska alltid kunna granska makten. Alla former av korruption måste motarbetas. Det gäller inte minst inom den politiska sfären. Vi vill ha en lag om att politiska partier och enskilda kandidater ska offentliggöra sina bidragsgivare. Civil olydnad har varit en viktig del av kampen för demokrati. Med civil olydnad menas handlingar som i dag är förbjudna, men som uppmärksammar orättvisor och samhällsproblem enligt principerna om ickevåld, öppenhet, strävan efter dialog och beredskap att ta sitt straff. Även fortsättningsvis kan civil olydnad vara betydelsefullt i demokratin. Vi vill värna människors rätt till integritet och privatliv. I dag är den rätten hotad av både statliga och kommersiella aktörer. Som individ ska det vara lätt att få reda på vilken information myndigheter eller företag har registrerat om ens person. Ingen otillbörlig registrering eller övervakning baserad på politiska åsikter eller demokratisk verksamhet får förekomma. Demokratin måste försvaras med demokratiska medel. De ökade möjligheterna till övervakning kräver att politiken slår vakt om människors möjlighet att värna sin integritet. Vi motsätter oss alla lagar som innebär oproportionerliga ingrepp i integriteten. Brotts- och terrorbekämpning är viktigt men ska inte ske på bekostnad av mänskliga rättigheter. ....................Ò .......... ....................... En avförutsättningarnaförenvälfungerande demokratiär attmänniskorkankänna sigtrygga och säkra.Detär viktigt att mankanlitapåden offentliga makten.Dettakrävertransparens och öppenhetsåvälsom ett effektivt och välfungerande rättsväsen somhar allmänhetensförtroende. Detskafinnasgod medborgerliginsyni all rättskipande ochrättsvårdande verksamhet och detärviktigtattenmångfald avbakgrunderoch perspektivfinns representeradeinombådepolis, åklagarväsen ochdomstolar.Vivill värna det medborgerliga deltagandetirättsprocessen, och villdärför utveckla nämndemannasystemet genom attlåtaflerän depolitiskapartierna nominera nämndemän. Polisen ska ges förutsättningar att arbeta såväl hjälpande och stödjande som ordningshållande, brottsutredande och brottsförebyggande. Rättssäkerheten ska tryggas samtidigt som de rättsvårdande myndigheterna ska ges de verktyg som krävs för att bekämpa kriminaliteten och öka tryggheten i samhället. Rättspolitiken ska sätta brottsoffret och dennes utsatthet i centrum. Den grova organiserade brottsligheten utgör ett hot mot demokratin och människors frihet. Detbrottsförebyggande arbetetärgrundenför ett tryggtsamhälle medlågkriminalitet.Detviktigastebrottsförebyggande arbetet skergenom att minska marginaliseringen och utsattheteni sam 5 hället.Barnibehov avsärskiltstöd skauppmärksammasochges adekvathjälp avbland annat skola, socialtjänst och sjukvård såtidigt som möjligt.Samverkan mellan olika aktörer som kommerikontakt medbarn och ungairiskzonen, och somkanbidratill att relevantaåtgärder sätts in,bör stärkas.Hinderför denna samverkanbör arbetasbort. Brottspåföljder har både ett brottsförebyggande och ett rehabiliterande syfte. Kriminalvård ska vara human och ha som mål att den som dömts inte ska återfalla i kriminalitet. Alkohol och andra droger orsakar samhället enorma kostnader och drabbade individer stort lidande. Polisens arbete ska därför fokusera på att motverka försäljning och langning av narkotika. Den enskildas missbruk är en sjukdom och vi vill se ett ändrat fokus från straff till vård. Personer som lider av missbruksproblematik ska erbjudas bästa möjliga hjälp och stöd, att komma ur sitt beroende och att få ett värdigt liv genom sådant som sprututbytesprogram och medicinering. Målet är ett narkotikafritt samhälle. .............. Entryggbarndommedgodamöjlighetertilllekska varaenrättighetföralla.Barnäraktivamedskapare avsamhälletochskaintesessompassivamottagare av detsamhällesomvuxnaskaparåtdem. Samhället ska vara anpassat till olika familjekonstellationer. En familj bygger på kärlek, trygghet och respekt, inte på föreställningar om hur en familj ska vara. Ekonomiskutsatthetärenriskfaktorförbarnshälsa ochförderasresultatigrundskolan.Barnifamiljeri ekonomiskutsatthetharocksåsämretillgångtill fritidsaktiviteter.Detbehövsenpolitiksomger ökaderesursertilldesämstställdafamiljernaföratt geallabarntrygghetochminskaklyftornaiSverige. Ekonomiskutsatthetska integåiarv. Vi vill särskilt satsa på stöd till barn i familjer där det förekommer våld, missbruk eller psykisk ohälsa. Barnets rättstrygghet måste stärkas om det finns misstankar om våld eller sexuella övergrepp. Satsning på verksamheter som är viktiga för barn och unga kan innebära stora mänskliga och långsiktiga vinster. Skolans förmåga att se och möta varje elev måste stärkas. Det behövs gott om platser där barn och unga kan mötas och utöva friluftsliv, idrott och kultur. Barn ska vara med och utforma samhället. FN:s barnkonvention ska bli svensk lag och politiska beslut bör föregås av en barnkonsekvensanalys. Långsiktighet är inte bara ett synsätt inom miljöpolitiken utan även avgörande när det gäller samhällsplanering och ekonomisk politik. Att satsa på barnen är en investering i framtiden. ......... ...." Genom skolan ska barn och ungdomar få viljan och redskapen att lära och utvecklas genom livet. I skolan ska varje barn lära sig att läsa, skriva och räkna, skapa och delta i samhällsdiskussionen, samarbeta och umgås med andra och påverka sin egen livssituation. Skolan ska ge varje barn möjlighet att vara sig själv och växa till den hen vill vara. Det ska inte finnas lyckade och misslyckade elever, inte heller bra och dåliga skolor – alla har rätt att lyckas och utvecklas i skolan. Elever måste sättas i centrum som de tänkande och kreativa individer de är. En fungerande skoldemokrati är en viktig del av en bra skola. Eleven ska vara medveten om sina rättigheter och skyldigheter samt få förutsättningar och möjlighet att kritiskt granska och påverka både samhället och sin egen skolsituation. Politikens uppgiftär attskapaförutsättningarför en skoladär vikanlitatill elevens nyfikenhet och lärarenskompetens.Politikens uppgiftärinte att detaljstyra ochkontrollerapedagogenidennes arbete.Förändringsarbeteiskolan måsteförankrasi samspel medskolan, eleverna och alla som arbetardär. 6 Lärarna skage eleverna detstöddebehöverför att kunna utvecklas utifrån sinaförutsättningar.För att mötet mellanlärare och elev skafungera behöver skolantillräckligtmedresurser.Undervisningen ska utformas utifrån varje elevs unika behov,oavsett om detinnebär attge extra utmaningar eller extra stöd,och med möjlighettill individuelltanpassad studieteknik.Läraren skaha rätt att ordinera extra stödtillden elev som behöver det. Allayrkesgrupperiskolanär viktiga.Skolans uppgiftärintebara attge eleverna engod utbildning och engod elevhälsa, utan också attge eleverna verktygför attfungera som aktiva samhällsmedborgare.Skolbiblioteken ochITär centrala resurserför skolanspedagogiska arbete. Fritidshemmenkan skapa mångsidighet,helhet ochkontinuitetibarnsutveckling ochlärande i detidiga skolåren.Enfungerandefritidshemsverksamhet möjliggörför eleverna attfå erfarenheter av atthantera sociala situationer, träna språketoch att respektera andra Skolan ska vara tillgänglig för alla och därför ska hinder undanröjas så att alla kan delta på sina villkor. Barn med psykisk, fysisk eller intellektuell funktionsnedsättning, och andra barn som behöver anpassningar och stöd, ska kunna få detta för att nå sin fulla potential. Skolan ska skapa förutsättningar för psykisk hälsa och välmående. Rätt stöd som sätts in i tid är både mänskligt och samhällsekonomiskt mer effektivt än stöd som kommer senare i livet. Ledarskapet i skolan, från skolledare till enskild lärare, är viktigt för att långsiktigt säkra kvalitet i undervisning och utbildning. Lärare ska vara professionella och kunniga och ha den utbildning som krävs för uppgiften. Olika elever lär sig på olika sätt och undervisningen ska ta hänsyn till det. En bra skola har tydlig koppling till forskning och tar kontinuerligt in nya forskningsrön. Skolanskapräglas avförtroendefullarelationer och varje elev skagesinflytandeöver sin studieväg och skolmiljö.Skolan ska vara enplats där elevernas naturligalust attlära utvecklas. Skolan skaknyta antillelevernas utvecklingoch geåterkopplingpåderas arbetsinsatser och utveckling, något somkan skepå olika sätt.Vi oroas avdet ensidigafokusetpåbetyg och kontrolleriskolpolitiken, ochmotsätter ossbetygi äntidigareåldrar.Betygska användas när det finnsskälfördet,tillexempel somett avflera urvalsinstrumentförfortsatta studier, ochkan aldrig varadenendaformen avåterkoppling. I dag finns ofta erfarenheter från hela världen i klassrummet, och det är en av skolans tillgångar. Andra modersmål än svenska ska ses som fördelar och som resurser för den enskilda elevens lärande. Ämnesundervisning på modersmålet ger alla elever en chans att utveckla de kunskaper och förmågor som läroplanen uttrycker. Undervisningen i skolan ska ha en global utgångspunkt och ta hänsyn till elevernas bakgrund, tidigare erfarenheter, språk och kompetenser. Estetisk och skapande verksamhet är liksom motion och rörelse viktigt för att hela människan ska utvecklas. Etiska diskussioner och övning i kritiskt tänkande är viktiga inslag i undervisningen för att förbereda varje elev för att delta i samhällsutvecklingen. Skolan ska vara en reklamfri plats. Alla elever inom grund- och gymnasieskolan ska serveras god, näringsriktig, miljövänlig och helst närodlad skolmat. Det gäller även de som har en kosthållning baserad på etiska, religiösa eller medicinska skäl. Skolmaten ska vara avgiftsfri. Skolan ska arbeta aktivt för jämställdhet och lika rättigheter. Alla elever ska få det stöd och den uppmärksamhet de individuellt behöver oavsett könstillhörighet. Alla elever ska ha tillgång till sex- och samlevnadsundervisning med ett tydligt normkritiskt perspektiv. Stereotypa könsroller, mobbning och diskriminering av elever och skol- personal ska aktivt motarbetas. Homo-, bi- och transfobi och sexism ska inte tolereras i skolan eller någon annanstans. Diskussionen kring alla människors lika värde ska vara en naturlig del av undervisningen redan från skolstarten. Miljöpartiet bejakar pedagogisk mångfald i skolan, vare sig skolans huvudman är offentlig eller privat. Mångfalden ger elever och föräldrar möjlighet att välja en utbildning vars pedagogiska inriktning 7 passar eleven. Alla skolor, oavsett huvudman, ska vara föremål för fungerande kontroll genom en stark offentlig inspektion. Såväl förskolan som andra barnomsorgsformer ska hålla hög kvalitet för alla barn. Det ska finnas tillgång till barnomsorg i hela landet anpassad efter föräldrars olika arbetstider. Ett starkt pedagogiskt arbete i förskolan ger barn en bra start och goda möjligheter i skolan. Vi vill därför att det ska finnas god tillgång till väl utbildade pedagoger i förskolan. Alla förskolor bör tillämpa en genusmedveten pedagogik så att barnen får möjlighet att vara sig själva och inte tvingas in i samhällets snäva könsmallar. Alla barn ska ha lika möjligheter att utvecklas och leva sina liv utan att hämmas av rådande könsroller. Vi vill väsentligt sänka storleken på barngrupperna och öka vuxentätheten inom barnomsorgen. Vi tror på folkbildningen och det livslånga lärandet. När alla får möjlighet att bidra och möjlighet att välja sin väg i livet, kan ett starkt samhälle byggas. Därför ska alla få chansen att få slutbetyg från gymnasiet, även som vuxna. En mångfald av olika organisationsformer och pedagogiska inriktningar i skolan är bra. Komvux, folkhögskolor och andra frivilliga utbildningsformer, som de studieförbunden erbjuder, är viktiga och ger möjlighet till ett livslångt lärande. ........................................ ........................ô Sverige ska vara ett land där alla har möjlighet till livslångt lärande. Vår ställning som kunskaps- nation bygger på en väl utbildad befolkning och på forskning av hög kvalitet. Bildning är viktigt både för människan och för samhället. Vi värnar om en hög kvalitet i den högre utbildningen. Bland annat genom en undervisningsgaranti för antalet lärarledda timmar. Yrkeshögskolan ska ge möjlighet till kvalificerade utbildningar inom områden där behovet av arbetskraft är stort. Systemet för medelsfördelning till universitet och högskolor ska förändras och utformas så att det säkrar en hög kvalitet i både utbildning och forskning för såväl små som stora lärosäten. Lärosätenas självständighet och oberoende ska utvecklas i samspel med en stor offentlig insyn. Den akademiska friheten ska värnas och jämställdheten måste förbättras. Lärare och forskare ska ha goda och trygga arbetsvillkor, och studenters och doktoranders inflytande och rättssäkerhet ska säkras. Kunskap bidrar till förståelse för omvärlden oavsett om den är av kommersiellt intresse eller inte. Humaniora, konst och tvärvetenskapliga ämnen stärker och utvecklas i samklang med utbildningar i teknik, natur- och samhällsvetenskap. Grundforskning och forskningsfinansiering som inte är öronmärkt är nödvändiga förutsättningar för framtida kommersiella genombrott och en framgångsrik spetsforskning. Forskningen ska vara fri, men det är rimligt att en del av de pengar som samhället satsar kan vara föremål för politiska prioriteringar och strategiska satsningar. Detta får dock inte gå ut över grundforskningen eller universitetens och högskolornas frihet att själva utforma sin verksamhet. Arbetet med ökad jämställdhet, satsningen på förnybar energi och klimatforskning, och den breddade rekryteringen till forskarutbildningen är resultatet av medvetna politiska satsningar. Vi anser att högskolans folkbildande verksamhet och kontakt med samhället, den så kallade tredje uppgiften, är viktig och ska stärkas. Forskning i samverkan med det samhälle som omger akademin, företag såväl som offentlig sektor, är viktig för kvaliteten på forskningen och underlättar tillgängliggörandet av forskningsresultaten. Högskolan ska ha en öppen och pådrivande roll i samhället och främja demokratin samt tillgängliggöra forskningens resultat. Banden mellan arbetslivet och högskolorna ska vara starka. Arbetslivserfarenhet och andra språk ska ses som en merit vid antagning till högskolan. Vi eftersträvar en bred rekrytering till högre utbildning. Sverige som kunskapsnation har mycket 8 att vinna på om de grupper som i dag är under- representerade får bättre möjligheter att studera. Tillgången på högre utbildning ska vara god i hela landet. Regelverken ska utformas så att de under- lättar för studenter att fullfölja sina studier. Bland annat ska studiemedlen vara tillräckligt höga, det ska finnas rimligt stöd till studenter med barn och fungerande skyddsnät vid sjukdom. En grundläggande princip är att all högre utbildning ska vara avgiftsfri för alla studenter. Lärarnas pedagogiska roll ska värderas högt och deras pedagogiska kompetens ständigt utvecklas. Studenter ska alltid ges möjlighet att löpande utvärdera sin utbildning. Lärare inom såväl högre utbildning som inom grund- och gymnasieskolan ska ges goda förutsättningar till forskning inom ramen för sin tjänst. .................. Kultur handlar om både bildning och livskvalitet. Ett dynamiskt kulturliv med många olika aktörer bidrar till en vital demokrati. Miljöpartiet de grönas kulturpolitik bygger på att alla ska kunna utöva och ta del av kultur på jämlika villkor. Kulturen ska vara tillgänglig för alla. Kulturpolitiken ska öppna upp generösa utrymmen för kreativitet och skapande. All kultur är en social konstruktion och handlar om hur vi som sociala varelser ser på omvärlden och samspelar med den. Vi gröna ser på kultur som en evig process som förändras i takt med allt som sker i världen. En kultur kan aldrig vara bunden till en plats utan är ett resultat av många olika faktorer som påverkar vår identitet. Vi gröna menar att synen på kultur aldrig får leda till att vi reducerar individen till att främst ses som en del av ett kollektiv. De individuella variationerna är en fundamental del av den gröna kultursynen. Idetsom viidagkallarSverigehar detalltid rymts många olikakulturer, ochdetgör det också änidag.Detären avvårastyrkor.Ienochsamma individfinnsalltidspår avflerakulturella referenser.När makthavareiSverige elleri andra länderhar strävatefterkulturell enhetlighetså har detletttillmotsättningar ochövergrepp.Det finnspolitiska rörelseriEuropa somdömer ut idén om mångkultur som misslyckad.Men detär genomdrivandetavmonokulturensomgångpå gångnär denharprovatsihistorienhar misslyckats. Detharletttillkatastrofalaföljder.Vibejakar attolikaidéer ochkulturerkan samexistera och influera varandrai ett och samma samhälle. Miljöpartietvill att människor alltid skages rätt attdefiniera och utöva sin egenidentitetochkultur. Därförär stödtillolika sorterskulturyttringar viktigt. Kultur- och musikskolor samt skolor och studieförbund i landets kommuner är viktiga för att barn och ungdomar ska få stifta bekantskap med olika kulturuttryck samtidigt som de utvecklar den egna kreativiteten. Alla barn ska ha möjlighet att utöva kultur inom någon form av kulturskola oavsett familjens ekonomiska förutsättningar. Ett rikt kulturliv består av såväl klassiska institutioner som kulturutövande av fria grupper och individer. De statliga kulturinstitutionerna ska ha ett tydligt uppdrag att tillgängliggöra sin verksamhet i hela landet. Digital teknik ska användas på bästa sätt för att sprida kultur. Miljöpartiet de gröna vill se en upphovsrättslagstiftning, anpassad till dagens samhälle, som främjar kulturskapande i både klassiska och nya former. Upphovsrätten ska gynna ett aktivt och deltagande skapande och public services produktioner ska i möjligaste mån uppmuntra till fri användning. Kopiering och fildelning för privat bruk ska inte vara straffbart, samtidigt som upphovsmän ska ha rätt till en rimlig ersättning. Välförsedda och offentligt finansierade bibliotek ska garantera allmänhetens tillgång till ett brett kulturutbud. I ett kunskapssamhälle där det inte längre bara handlar om att finna utan också om att sålla information ökar behovet av att ha möjlighet att möta en utbildad bibliotekarie. Lån av böcker och andra medier ska vara avgiftsfria. Bibliotekens förekomst och kvalitet ska garanteras i lag. Kulturarvetärvårtgemensammaarv.Kulturhistorisk värdefulla byggnader, minnesmärken och andra 9 miljöer, såväl i städerna som på landsbygden, bör bevaras och vårdas för framtiden. Betydelse-fulla regionala och lokala museer bör stödjas av samhället. Ett demokratiskt samhälle kräver saklig information, aktiv samhällsgranskning och grävande journalistik. Vi värnar presstödet och vill att det omformas så att det stärker mindre aktörer. För att garantera en mångfald av åsikter och yttrandefrihet i samhället behöver vi ett oberoende och starkt public service samt lagar som motverkar för stora ägarkoncentrationer. Konsumenter ska ha möjligheter att göra fria och upplysta val. Vi vill begränsa reklamens utbredning, särskilt bland barn och unga. Sexistisk reklam och reklam riktad mot barn under tolv år ska vara förbjudet, liksom reklam för spel och alkohol. Fysisk rörelse är viktig för folkhälsan och välbefinnandet. Idrottsrörelsen är Sveriges största folkrörelse. Genom resurser till ungdoms- och breddidrotten, inklusive idrott för människor med funktionsnedsättning, korpidrott och motions- idrott, investerar vi i såväl livskvalitet som folk- hälsa. Det ska också finnas gott om möjligheter till spontanidrott. De pengar som kommer idrotten och andra kultur- och fritidsaktiviteter till del måste fördelas jämnt mellan könen. ...................................... För att alla människor ska kunna förverkliga sina drömmar om en hög livskvalitet måste alla ha samma möjligheter. Varje individ ska kunna skaffa sig det liv, den utbildning och det arbete hen önskar utan att samhällsstrukturer hindrar. Socioekonomisk bakgrund, könstillhörighet och könsuttryck, sexuell läggning, härkomst, funktionsnedsättning eller ålder ska aldrig vara hinder för att människor ska kunna utvecklas. Därför måste arbetet för lika rättigheter och mot diskriminering integreras på alla områden i samhället. Ingen ska utsättas för hatbrott eller hatpropaganda. Oavsett föräldrarnas ekonomiska och sociala förutsättningarskaallabarngeslikvärdigamöjligheter attutvecklas.Detbetydergodbarnomsorgochskola tillgängligaföralla,samtenskatte-ochsocialpolitik somtillförsäkrarallabarnengoduppväxtmiljö.Vi villförbättravillkorenförbarnsomidagleveri fattigdomgenomattgederasvårdnadshavarebättre möjligheterattförsörjasinfamilj. Miljöpartiet de gröna är ett feministiskt parti och det har vi varit sedan vi bildades. Vår feministiska politik har utvecklats från att se kvinnor och män som två fasta kategorier som kompletterar varandra till att i dag se komplexiteten i de samhällsstrukturer som låser in människor i begränsande, socialt konstruerade könsnormer. Vi ser att maktordningar som etnicitet, sexuell läggning, klass, och ålder samverkar med den samhällsgenomgående könsmaktsordningen. Detta vill vi ändra på. Indelningen i antingen kvinna eller man begränsar människor som inte entydigt kan eller vill identifiera sig som antingen eller. Ett tredje juridiskt kön skulle kunna vara ett sätt för transpersoner att slippa behöva pressas in i en tvåkönsmodell. Snäva könsnormer och brist på jämställdhet begränsar människors fria livsval. Det kan handla om kvinnor som trots goda meriter har svårare att göra karriär inom universitet och näringsliv eller män som av omgivningens förväntningar pressas till oönskade karriärvägar. Vi anser att alla människor ska kunna välja den väg i livet som passar dem utan att begränsas av gamla idéer om vad kvinnor och män bör eller kan göra. Osakliga löneskillnader ska inte förekomma och yrkens status och lönebild ska inte vara beroende av könsmönster. Viser attbegränsandekönsroller, osakliga löneskillnader ochstereotypaföräldranormer hänger samman.Entredeladföräldraförsäkring, där entredjedelavdagarnaöronmärksför respektive vårdnadshavare och restenkan fördelasfritt,är ettsätt attbryta medgamla mönster och stötta mäni attta ett mer aktivt föräldraskap.Närmänsuttag av föräldraledighetenökar stärksdessutomkvinnorspositionpå arbetsmarknaden.Dendel avföräldraförsäkringen somi entredelad modellkanfördelasfritt 10 skaäven vara möjlig attöverlåtatill entredje part somärdel avbarnetsfamilj. Våld i nära relationer ska behandlas på ett snabbt, samordnat och konsekvent sätt i ett samarbete mellan myndighet och organisationer. Vi vill ha fler mansmottagningar och kvinnojourer och bättre förutsättningar för dessa. Vi vill också se stöd och skydd för barn och vuxna som utsatts för psykiskt och fysiskt våld samt professionell behandling av våldsutövarna. Samhällets institutioner ska ha beredskap och verktyg för att motverka patriarkalt våld och våldshandlingar som utförs under påverkan av hedersföreställningar. All diskriminering ska motverkas. Hela samhället – myndigheter, arbetsgivare, fackföreningar och frivilligsfären genom till exempel antidiskrimineringsbyråer – ska involveras i arbetet mot diskriminering. Det krävs också en stark lagstiftning och en stark diskrimineringsombudsman. Om samhället ska bli öppnare behövs ett effektivare arbete mot alla former av diskriminering. Människor diskrimineras på grund av sin etnicitet, sitt namn eller sin brytning. Det vill vi motverka. Strukturell diskriminering och rasism ska upphöra. Alla som behöver ska erbjudas en högkvalitativ svenskundervisning. Utländsk utbildning ska snabbt kunna valideras och vid behov kompletteras. Alla människor, oavsett funktionsnedsättning eller förmågor, ska ha lika rättigheter, möjligheter och skyldigheter. Alla individer är olika, och samhället ska inte bara vara anpassat för de som utgör normen. Det är otillgängligheten i samhället som utgör det verkliga hindret för att personer med funktionsnedsättning ska kunna fungera och verka fritt. Bristande tillgänglighet är i sig en typ av diskriminering och måste därför bli en ny diskrimineringsgrund. Sverige har fem nationella minoriteter: samer, romer, judar, sverigefinnar och tornedalingar. Deras särskilda ställning, med egen kultur och eget språk, måste respekteras och stärkas. Samerna utgör ett urfolk som i enlighet med flera internationella konventioner har särskilda rättigheter som Sverige måste garantera. Sverige bör snarast ratificera FN:s konvention om urfolks rättigheter, ILO 169. Sverige ska arbeta för mänskliga rättigheter nationellt och internationellt. ................@ Många lever ett aktivt liv mycket längre än vad tidigare generationer har haft möjlighet till. Fler och fler får uppleva sin hundraårsdag. Många äldre är friska allt längre vilket är en stor samhällsresurs. Äldres kunskaper och erfarenheter är ovärderliga på många områden, till exempel som fortsatt yrkesaktiva eller som mentorer till yngre. Inom frivilligsektorn och föreningslivet gör många äldre stora insatser. Alla äldre är dock inte friska och många behöver tilltagande hjälp. Därför är det viktigt med en trygg och god äldreomsorg som utgår från de äldres individuella behov. Ett rikt liv kännetecknas av självbestämmande, socialt umgänge och möjlighet till deltagande. Även som äldre ska man ha möjlighet att uppleva samvaro, gemenskap och kunna delta i fysiska och kulturella aktiviteter. Rätten till bostad är grundläggande i vårt land. För äldre blir det efterhand allt viktigare att ha en fungerande bostad och, när man så behöver, rätt till stöd och hjälp i hemmet. En fungerande hemtjänst kan ofta vara en förutsättning för att kunna bo kvar i sitt hem. Kommunerna behöver bli bättre på att planera så att den äldre när hen så önskar och behöver ska kunna erbjudas äldreboende, service- boende eller annat lämpligt alternativ. Alla ska kunna lita på kvaliteten och tryggheten i omsorgen, oavsett vem som utför den. Som anhörig är det ofta smärtsamt att se när en äldre närstående insjuknar. Då ska man kunna vara trygg med att det finns en god omsorg med hög kvalitet och tillräcklig och utbildad personal. De anhöriga ska känna sig sedda och deras önskemål tillmötesgås så långt som det är möjligt. Det ska finnas äldreomsorg med olika inriktningar. Önskemål om vårdpersonalens språkkunskaper ska tillgodoses. Frivilliga insatser i äldreomsorgen ska uppmuntras. 11 Äldreomsorgen står inför en stor utmaning med ett ökat antal äldre i befolkningen, samtidigt som det sker stora pensionsavgångar bland omsorgspersonalen. I framtiden kommer allt färre unga behöva försörja och vårda allt fler äldre. Vi vill möta den utmaningen. På samhällsekonomisk nivå är det viktigast att ge unga människor vägar in i arbetslivet. För äldreomsorgen handlar det om åtgärder för att bli en bra arbetsgivare. Personaltätheten måste hålla tillräcklig nivå så att de som arbetar i äldreomsorgen slipper hamna inför omöjliga situationer som att ensamma behöva utföra lyft som egentligen kräver två personer. En satsning på ökad bemanning genererar nya jobb samtidigt som kvaliteten ökar. Maten som serveras inom äldreomsorgen ska vara näringsrik, miljövänlig och helst närodlad. 12 ................s Människan har ett ansvar som sträcker sig utanför sin egen person och längre än sin generation. Våra livsmöjligheter avgörs av hur väl vi klarar att leva i samklang med det ekologiska systemet. Den gröna ideologin handlar inte bara om människors förhållande till varandra, utan ser också vårt beroende av allt det som vi har omkring oss. Industrisamhällets framväxt har lett till välfärd och teknisk utveckling, bättre hälsa och längre livslängd. Vi har på många sätt fått ett bättre liv. Samtidigt går exploateringen av naturresurserna långt utöver naturens egen återställningsförmåga. Den biologiska mångfalden håller i snabb takt på att utarmas. Växthusgasutsläpp i atmosfären, orsakade av människan, leder till varaktiga klimatförändringar. Många olika typer av miljögifter hotar vår hälsa och vår miljö. Vår livsstil i Sverige och andra ekonomiskt starka länder ger upphov till miljöeffekter långt utanför våra länders gränser. Vi måste ställa om våra samhällen så att vi klarar att leva ett gott liv i framtiden utan att förstöra möjligheterna för oss själva, människor i andra länder och kommande generationer. Denna omställning kräver en effektivare hushållning med naturresurser och en jämnare fördelning. Vi i de rika länderna måste anpassa vår konsumtion så att våra ekologiska fotavtryck per person snarast når en globalt hållbar nivå. För att skydda miljön ska försiktighetsprincipen tillämpas så långt det är möjligt. Om det föreligger hot om allvarlig eller oåterkallelig skada, får inte avsaknaden av full- ständig vetenskaplig bevisning användas som ursäkt för att skjuta upp åtgärder för att förhindra miljöförstöring. Det finns ännu möjlighet att vända utvecklingen och undvika katastrofala miljöeffekter. Det kräver en modig miljöpolitik, en jämlik fördelning och ett solidariskt arbete för att minimera konsekvenserna av de miljöförändringar som redan har skett och håller på att äga rum. .................................. Naturenfungerarsomettkretslopp.Dettamåste samhällettahänsyntillochefterlikna.Allverksamhetmåstehållasiginomderamarnaturensätter. Vimänniskorleverpåenplanetmedbegränsade resurserochdetsättergränserförvårthandlande. Mänskligpåverkanärnudenhuvudsakligakraft somdriverstoraförändringarivärldensmiljö.Redanidagöverskridervi, ellerriskerarattöverskrida, naturensramarpåfleraområden.Blandannatuttagetavändliganaturresurser, utsläppavväxthusgaser, förlustavbiologiskmångfald,tillförselavkväveoch fosfortilllandochhav,förändradmarkanvändning, globalvattenanvändning,försurningavhavenoch spridning av luftpartiklar och miljögifter. Konsekvensernaavdettakanblikatastrofalaförenstordel avmänskligheten.Påsiktkandeförändrasjälva förutsättningenförlivpåjorden. Många av dessa processer är starkt sammanlänkade. Om gränsvärdena passeras på ett område så försämrar det möjligheterna att hålla sig inom säkra nivåer på andra områden. Vi måste snabbt minimera utsläppen från förbränning av fossila bränslen, för att undvika en katastrofal temperaturhöjning och försurning av sjöar och hav. Naturskogar, våtmarker och andra utsatta vegetations- typer ska återskapas för att öka den biologiska 13 mångfalden, öka tillgången och kvaliteten på sötvatten och för att minska läckaget av näringsämnen till sjöar och hav. Detta ställer stora krav på en politik som tar hänsyn till naturen på ett helt annat sätt än vad som sker i dag. Sverige måste ta ansvar för de effekter vår produktion och konsumtion har på de ekologiska systemen, både här och i andra länder. Miljöpartiet de gröna vill se ett samhälle där hushållningen med resurser är så effektiv och rättvis att grundläggande mänskliga behov kan tillgodoses överallt. För att klara detta måste vi minska användningen av ändliga resurser, sluta slösa med energi och material och i ökad utsträckning återanvända och återvinna. Målet är slutna kretslopp. Det ger både en hållbar produktion av ekosystemtjänster och stärkt motståndskraft, ofta kallad resiliens, inom mänskliga samhällen och ekosystem. Gruvnäringen i Sverige ska bygga på långsiktig hushållning med mineraltillgångar. Miljöhänsyn ska väga tyngre än kortsiktiga exploateringsintressen. Vi vill att det ska vara både enkelt och billigt för var och en att återanvända och reparera saker i stället för att hela tiden köpa nytt. Vi vill se skarpa krav på producenterna att kretsloppsanpassa nya produkter och fasa ut miljöskadliga ämnen. Vi ser att ekonomiska styrmedel och lagstiftning behövs för att uppnå bättre hushållning med energi och material. Vi vill verka för minskad användning av plast. ....................... ..................å Det gröna engagemanget grundar sig i insikten om vår delaktighet i och vårt beroende av det ekologi- ska systemet. Naturen är också en plats för rekreation, skönhetsupplevelser och för ökat välbefinnande. Respekten för naturens mångfald är en grundvärdering i den gröna ideologin. Vi anser att allt levande har ett egenvärde oavsett dess nytta för människan. Många av jordens livsmiljöer håller på att förstöras, och många arter av växter, svampar och djur håller på att gå förlorade. Även i Sverige är många arter akut hotade. Överexploateringen av arter och livsmiljöer, invaderande främmande arter, miljö. gifter och klimatförändringar är de största hoten mot den biologiska mångfalden. Förlusterna är allvarliga. De hotar att leda till kollaps av eko- system och att vi går miste om ekosystemtjänster, som pollinering av grödor, luft- och vattenrening eller fiskbestånden i våra vatten. Naturvårdsfrågorna i Sverige och inom EU måste få större tyngd. Sveriges och EU:s skyddade arealer är för små och otillräckliga för att kunna säkerställa den biologiska mångfalden. Skyddet av hav, skogar, våtmarker, stränder och flera andra biotoper måste utvidgas och skärpas. Bruk av skog, vatten och mark måste kopplas till ett ansvar för att den biologiska mångfalden inte ska utarmas. En stor del av världens biologiska mångfald finns i regnskogen. I dag pågår en avskogning av de tropiska regnskogarna som både påverkar naturen och människan. Orsakerna till avskogningen är många: timmeruttag, gruvdrift, oljeutvinning, utbyggnad av vattenkraft, vägbyggen, anläggning av betesmark och odling. Konsumtion av exempel- vis palmolja och av kött från djur uppfödda på soja från tidigare regnskogsmark bidrar till avskogningen. Sverige måste arbeta för gemensamma åtaganden för att stoppa utarmningen av den biologiska mångfalden. Skydd av hotade arter och naturmiljöer är av global betydelse och behöver därför överstatliga beslut. Rent vatten är en förutsättning för att kunna bevara den biologiska mångfalden. För att få sjöar, vattendrag och hav att tillfriskna krävs omfattande åtgärder för att minska utsläpp från transporter, avlopp, jordbruk och industri. Utsläpp av miljöstörande ämnen såsom kväve, fosfor, läkemedels- rester, hormonstörande ämnen, tungmetaller och nanopartiklar ska reduceras bland annat genom att industri- och hushållsavlopp separeras, avloppsnät och avloppsrening förbättras och miljöfarliga produkter byts ut. Sverige måste verka genom internationella organisationer, i synnerhet EU, för att alla länder runt gemensamma vatten ska införa dessa åtgärder. Miljögifter är i dag ett allvarligt hot mot såväl människor som natur. Försiktighetsprincipen 14 måste gälla vid bedömning av kemikalier, eftersom det kan ta tid innan negativa effekter blir tydliga. Barn är särskilt känsliga för många miljögifter, och de produkter och miljöer som barn använder och vistas i måste värnas särskilt. Prövningen och kontrollen, såväl nationellt som inom EU:s kemikaliepolitik, måste vara skarp. Särskild hänsyn måste tas till riskerna förknippade med kombinationer av olika kemikalier. ................... Denpågåendeochaccelererandeklimatförändringen äventyrar vår framtid. Den påverkar inte bara enskilda människors liv, utan även den globala ekonomin och överlevnaden för hela nationer. Trots vår kunskap om allt detta fortsätter utsläppen av växthusgaser att öka. Sverigeskavaraledandeiattminskadenmänskliga påverkanpåklimatet.Viärettavdeländersom industrialiseradestidigt,ochviharetthistoriskt ansvarfördeutsläppsomgenereradesnärvibyggde uppvårtvälstånd.Viorsakarfortfarandebetydligt högreutsläppperpersonänvadsomärglobalthållbart. Sverigeharocksåuniktgodaförutsättningar attledaomställningentilletthållbartsamhälleoch visamöjligheternatillenannanutvecklingsmodell. Dåfårvåromställninglångtstörreeffektänbara våraegnautsläppsminskningar. Sverige ska ha en pådrivande roll i internationella klimatförhandlingar och utveckla klimatsamarbetet mellan länder, samtidigt som vi visar solidaritet i handling genom kraftfullt stöd till fattigare länder. För att vi ska vara trovärdiga krävs att Sveriges utsläpp av växthusgaser per person snarast minskar till en globalt hållbar nivå. För att nå klimatmålen krävs att takten i den miljötekniska utvecklingen ökar. Den totala energi- och resursförbrukande konsumtionen måste minska till en hållbar nivå. Det behövs en politisk omställning som underlättar en övergång till en mer hållbar livsstil. Konsumtion som har negativ klimatpåverkan, såsom fossilt drivna transporter, fossil energi och animalier, måste minska. Politiska insatser måste samverka med ett medborgerligt engagemang för en mer hållbar livsstil. En sådan livsstilsförändring kommer att se olika ut för olika människor. Genom att resa mer miljövänligt, handla mer lokalt producerat, äta mer vegetarisk mat, energieffektivisera hemmet och konsumera färre prylar ökar möjligheterna att leva ett gott liv inom de ramar miljön sätter. Vi är övertygade om att ett klimatsmart samhälle också är ett samhälle som är bättre för människor. Politik och attitydförändringar kommer att ge utrymme för fler att värdera fri tid och nära relationer högre än lönearbete och materiell status. Förattklaraklimatmålenkrävsettklimatpolitiskt ramverkmedbindandetakförvårklimatpåverkan såväliSverigesom internationellt.Kraftfullaekonomiskastyrmedelärnödvändiga. Klimatsmartaval skavarabilligare.Klimatskadligasubventionerska fasasutochklimatmålenskastyrainvesteringarna i infrastruktur.Gas-ocholjeborrningsamturanbrytningskaförbjudasiSverige. Torvskabetraktassom ettfossiltbränsle.Internationelltvillviverkaförett moratoriummotallnyexploateringavfossilabränslen. För att minska mängden växthusgaser i atmosfären kan koldioxidlagring eller andra metoder för att binda växthusgaser behövas. Dessa får dock inte bli en ursäkt för att fortsätta utsläppen. Försiktighetsprincipen ska vara vägledande så att vi inte orsakar nya miljöproblem när vi försöker lösa gamla. Stora förändringar kräver att människor går samman. Decentraliserad energiproduktion, nya transportvanor och hållbara konsumtionsvanor är några exempel på åtgärder som är en del av den omställning som vi måste lyckas med tillsammans. En offensiv klimatpolitik måste kombineras med ett arbete för jämlika och jämställda villkor. ..................' ..................' .. ........... @ Jordbruket, skogsbruket och fisket är mycket betydelsefulla näringar i Sverige. De behövs för att på ett hållbart sätt försörja oss med livsmedel och är viktiga för en god ekonomi och en levande landsbygd. Därför måste de tas tillvara så att de 15 kan vara till glädje och nytta för människor i dag och för kommande generationer. Miljöpartiet anser att EU:s gemensamma jordbrukspolitik ska inriktas på att skydda och främja småskalighet, biologisk mångfald och miljöhänsyn. I en värld med ökande befolkning är det av stor vikt att bevara jordbruksmarken och dess bördighet. Markpolitiken i Sverige måste vara långsiktig och goda jordbruksmarker ska skyddas från exploatering. Betade ängs- och hagmarker är viktiga inslag i landskapet för att bevara den biologiska mångfalden och kunskapen om landets kulturhistoria. Det är också viktigt att den biologiska mångfalden inte reduceras genom ensidig odling och olämpliga jordbruksmetoder. Användandet av genetiskt modifierade växtutsäden eller avelsdjur, GMO, för med sig nya typer av risker. All eventuell användning av GMO måste därför styras av försiktighetsprincipen. Jordbrukspolitiken ska bidra till att minimera negativ miljöpåverkan. Detta ska göras genom såväl lagstiftning, ekonomiska styrmedel och kunskapsuppbyggnad. Det är inte rimligt att de svenska kraven för miljön, klimatet och god djurhållning slår ut svenskt jordbruk och i stället gynnar jordbruk där miljökraven är lägre och djuren behandlas sämre. Därför vill vi utjämna konkurrensen genom att upphandla lokalproducerat till offentliga kök, genom tydlig ursprungsmärkning och genom ekonomiska styrmedel som missgynnar livsmedel som tillverkats under sämre villkor än vi tillåter i Sverige. Sverige ska ha ett livskraftigt jordbruk i hela landet med god konkurrenskraft. Uppfyllande av miljökvalitetsmålen och hänsynstagande till djurens behov ska stå i fokus och produktionen ska bidra till en hög självförsörjningsgrad på baslivsmedel och foder. Moderna jordbruksföretag står i dag ofta på flera ben som till exempel specialiserad livsmedelstillverkning, egen energiproduktion, gårdsbutiker, turism och naturskydd. Miljöpartiet ser positivt på denna utveckling och verkar för en övergång till ett ekologiskt och kretsloppsanpassat jordbruk. Övergången till ekologisk odling ska stöttas genom jordbruksstödens utformning, regelverk för offentlig upphandling och genom lagstiftning. Sverige är i hög grad ett skogsland. Skogen är viktig både för den biologiska mångfalden, som råvara för skogsprodukter och energi och som rekreationskälla. Vi stödjer och uppmuntrar forskning och start av företag för att utveckla nya högkvalitativa och miljövänliga produkter ur skogen. En levande skog har lång omloppstid och därför är den extra sårbar för dålig skötsel och ogenomtänkt exploatering. Ansvaret att återplantera långsiktigt med rik artvariation och för klimatanpassning måste stärkas, speciellt gällande inslaget av löv och tall. Vi anser att en större del av den svenska skogen behöver präglas av artvariation som ger en långsiktig livskraft. Därför måste skogsbruket modern- iseras genom mer av hyggesfria avverkningsmetoder och genom mindre kalhyggen Särskilt värdefull skog ska skyddas från avverkning. Det behövs både större sammanhängande områden och många mindre områden som undantas från produktionsskogsbruk. För att hejda förlusten av biologisk mångfald är det också angeläget att återställa och restaurera naturvärden i redan påverkad skog. Människan har hämtat sin näring ur havet sedan urminnes tider. Genom bland annat industrifiske, övergödning, miljögifter och exploatering av kustzoner har störningarna på dessa ekologiska system ökat på ett ibland katastrofalt sätt. Sverige ska vara pådrivande inom EU och globala organisationer för ett ansvarsfullt fiske som återuppbygger utfiskade bestånd och inte tar ut mer än återväxten. Fiskerätter ska fördelas utifrån hållbarhetskriterier. Hårda krav ska ställas på de företag som får utnyttja den gemensamma fiskresursen för kommersiell vinning. Sverige ska arbeta internationellt för att förbudet mot kommersiell valfångst efterlevs. Det kustnära fisket och fritidsfisket har en viktig roll både för människors rekreation och för att våra skärgårdar ska hållas levande. Vi vill se ett starkt skydd av nyckelbiotoper i vatten och av områden som är speciellt viktiga för havets biologiska mångfald eller för många arters fortplantning. Ett sätt att öka skyddet är att inrätta marina reservat och införa fiskefria områden. 16 .............. Alla djur har ett egenvärde oavsett deras nyttighet för människan. Djurens rätt att bete sig naturligt och slippa utsättas för lidande kräver stora förändringar i djurhållningen. Människan föder upp djur bland annat för att de ska bli mat, kläder och testare av olika produkters farlighet. Detta innebär ett mycket stort ansvar för att djuren behandlas väl. Skarpa djurskyddskrav ska bland annat ställas i den offentliga upphandlingen. Vi vill förbjuda att djur hålls endast för pälsändamål. Ambitionerna i djurskyddslagstiftningen speglas inte fullt ut i verkligheten, och lagens efterlevnad måste förbättras. Djuren ska ha rätt och möjlighet till ett naturligt beteende och då måste djurhållningen anpassas till det. Kontrollerna ska förbättras. Vi vill införa en djuretisk ombudsman och öka möjligheterna för djurskyddsorganisationerna att föra talan i djurskyddsmål. Vi vill stärka arbetet mot avel som kan medföra lidande för djuren. Djurskyddslagen ska tillämpas fullt ut även i livsmedelsindustrin. Det måste avsättas tillräckliga resurser för att kunna göra täta och effektiva kontroller av såväl djurhållning som transporter och slakt. För att komma längre i djurskyddsstandard måste Sverige arbeta aktivt inom EU för att höga standarder ska gälla inom hela unionen, och för att enskilda medlemsländer ska få gå före. Sverige ska verka för att bindande regler om djurskydd utarbetas också inom FN och WTO. Sverige ska arbeta aktivt för att bekämpa tjuvjakt och handel med utrotningshotade arter. Internationella handelsavtal ska inkludera djurskyddsfrågan för att undvika att billig import av mat från länder med sämre djurskydd ökar. Djurförsök ska snarast tas bort och ersättas av djurfria metoder. De som jobbar med djur måste ha god kunskap om djurs beteenden. Ökad forskning på alternativ till djurförsök kan göra Sverige till en ledande nation på området. Så länge djurförsök finns kvar ska kontrollen av dem förbättras. Det är viktigt att det ekologiska perspektivet sätts i fokus vid jakt och att naturvårdsintressen får företräde. Även djurskyddsaspekter ska beaktas. Jaktformer som utsätter djur för onödigt lidande ska inte vara tillåtna. Sverige ska hysa långsiktigt livskraftiga stammar av de fyra stora rovdjuren: varg, lo, björn och järv. Rovdjurens existens i Sverige ska inte enbart ses som överlevnad utan rovdjuren måste även ges möjlighet att återfå något av sin ekologiska funktion i ekosystemet. 17 ....? ..........s Ommänsklighetenskaklaravårtidsutmaningar i formavklimatförändringar,resursbegränsningoch växandeekonomiskaklyftorbehövsdetenny ekonomiskpolitik.Ensådanmåsteutgåifrånalltdet godavikanskapaijämlikasamhällensomverkar inomnaturensbegränsningar,utifråndelivsviktiga funktionersomupprätthållsavekosystemen. Vimåsteställaomtillenekonomisomtarlångsiktiga hänsyntillmiljönochmänniskorsvälbefinnande. Ständigekonomisktillväxtitraditionellbemärkelse ärintemöjligpåenplanetmedbegränsaderesurser. Detärpolitikensansvarattformamarknadens förutsättningarsåattresurseranvändsiöverensstämmelsemedvillkorenför etthållbartsamhälle. När det ekonomiska systemet krockar med det ekologiska systemet är det ekonomin som måste anpassas. Det handlar om några självklara principer. Det som är bra för människor och miljö ska vara billigt, det som är dåligt ska vara dyrt och det som är alltför skadligt ska förbjudas. Den ekonomiska politiken ska sträva efter jämlikhet. Det är en viktig grund för samhällens och människors välbefinnande. Jämlikhet handlar inte om likhet utan om att ge alla goda möjligheter utifrån olika förutsättningar. I samhällen med ökande ojämlikhet bryts framtidstron ner och den sociala oron ökar. ......? ........................ Ekonomi är läran om hushållning med knappa resurser. Men i dag beter sig mänskligheten som om jordens resurser är oändliga. Det är ett kortsiktigt perspektiv som måste överges. Det är dags att tänka långsiktigt. Människors möjligheter att själva styra sina liv och att förverkliga sina idéer ger ekonomin dess styrka och förändringskraft. Sveriges välstånd och välfärd är beroende av kunniga och arbetande människor och av ett mångsidigt och tekniskt högt utvecklat näringsliv stöttat av en fungerande välfärdssektor. Vi vill främja utbildning och arbete som ger människor mer makt över sina liv. Alla aktörer i ekonomin har ett ansvar att ta etiska, sociala och ekologiska hänsyn. Samhällets lagar och spelregler ska uppmuntra detta. Långsiktighet och balans ska prioriteras före kortsiktiga vinstintressen. Etiskt företagande och arbete ska premieras. De ekonomiska klyftorna ska minska. De verkligakostnadernaför attutvinna råvaror ochför attframställa ochdistribueraprodukter skaåterspeglasiprisetpå marknaden.Detta byggerpåprincipen om attdetärförorenaren som skabetala.Kostnader somdrabbar miljön eller annanpart skainkluderasiprisetgenom skatter, avgifter eller andralämpligainstrument.Dettaär en särskilt viktigprincipiklimatpolitiken,där alla varor ochtjänstersklimatpåverkan också ska synasipriset. Marknaden erbjuder allt mer komplicerade produkter och tjänster. Vi vill ha ett starkt skydd för konsumenterna genom god konsumentvägledning, tydlig märkning av varor och tjänster och en relevant konsumentutbildning i skolan. Det finansiella systemets uppgift är att stödja den reala ekonomin genom att kanalisera sparande och investeringar och att tillhandahålla betalningstjänster och riskspridning. Girighet, överskuldsättning och spekulation ska motverkas. En alltför hög privat skuldsättning är en risk för individen 18 och för samhällsekonomin. Vi kan inte bygga en fungerande långsiktig ekonomi på en ständigt växande skuldsättningsnivå. Samhället måste motverka det överdrivna risktagande som dominerat finansmarknaderna. Vi vill se en skatt på vissa finansiella transaktioner. En uppdelning av bankernas verksamhet mellan traditionell affärsverksamhet och mer spekulativ investmentverksamhet bör övervägas. Sverige ska ha en ekonomi som är öppen mot omvärlden och verka för frihandel på rättvisa villkor. Omställningen av vår ekonomi kräver nya konsumtionsmönster och stora investeringar i ny miljövänlig teknik, infrastruktur, bostäder, energiförsörjning och matproduktion. Vi vill se stabila och långsiktiga spelregler för företag och hushåll för att underlätta detta. Staten ska genom lagstiftning och övervakning se till att sunda villkor råder på marknaden. Staten ska också genom en förebyggande finans- och penningpolitik dämpa effekter av konjunkturvariationer och verka för stabila priser och låg arbetslöshet. ......? ........... ............4 ......ô Människan är kreativ och skapande. Det är människans uppfinningsrikedom som har lagt grunden för de senaste seklernas snabba ekonomiska utveckling. Den har gjort att allt fler människor i vår värld har kunnat få sina grundläggande behov tillgodosedda, och leva i trygghet och välstånd. Samtidigt har den ekonomiska utvecklingen byggt på en tillväxt som i stor utsträckning kunnat genereras genom ökad resursförbrukning, och som har lett till ökade utsläpp av växthusgaser och minskad biologisk mångfald. En ständig jakt på ekonomisk tillväxt utan hänsyn till vad den består av riskerar att leda till långsiktiga miljömässiga och sociala problem, att människor slits ut och att förutsättningarna för en långsiktigt hållbar välfärd raseras. Vi måste därför ställa om våra samhällen och ekonomiska system utifrån nya ekonomiska realiteter där all ekonomisk utveckling måste ske inom de ramar som naturen och människors välbefinnande och livskvalitet sätter. Det är möjligt, men kräver såväl tekniska som sociala innovationer. Ofta hänger dessa samman. Ny teknik gör det enklare att leva på ett sätt som är bättre för miljön. Vi kommer fortsätta att finna smartare och effektivare sätt att tillverka produkter och utvinna energi. Genom ekonomiska styrmedel och marknadsregleringar ska vi använda den ekonomiska utvecklingskraften för att möta miljö- och resursutmaningarna. Livsstilsförändringar krävs för att miljövinsterna av teknisk utveckling inte ska omintetgöras av ökad konsumtion. Vårt sätt att leva, som individer och tillsammans som samhälle, kommer att förändras. Vår livsstil och konsumtion måste hålla sig inom det som är långsiktigt och globalt hållbart. Det här är en utmaning som är större än de som mänskligheten mött i historien, men erfarenheterna av det vi har åstadkommit kan användas för att klara den. Vi har i vårt land en tradition av att prioritera reformer som ger en annan utveckling än den som kortsiktigt kan mätas i växande bruttonationalprodukt, (BNP), såsom lagstadgad semester, arbetsskydd och föräldraledighet. Vi är övertygade om att ett hållbart samhälle för både människor och miljö även framöver kräver att vi har modet att fatta politiska beslut, även om värdet av dem inte enkelt kan räknas hem genom traditionell tillväxt. I grunden behöver vårt sätt att mäta ekonomin och värdera framsteg förändras. Vi behöver andra mått på vad som är en god utveckling än traditionell BNP-tillväxt, som bara mäter hur mycket vi producerar och konsumerar. Det handlar om mått som i stället fokuserar på hur människor och miljö mår. Det är uppenbart att ett system inte är hållbart när det som är långsiktigt katastrofalt för såväl samhälle som ekonomi kan vara kortsiktigt lönsamt. Genom nya mått på välfärd och förändrade prioriteringar kan vi bygga en ekonomi som gör sig fri från beroendet av ständig tillväxt. En del i det arbetet är att verka för en solidarisk fördelning av resurser, som ger ökad ekonomisk trygghet i osäkra 19 tider. Möjlighet till såväl arbete och försörjning som ett hållbart arbetsliv med gott utrymme för tid fri från lönearbete är en viktig del. Den offentliga sektorn är för sin finansiering i dag alltför tillväxtberoende då den till stor del består av verksamheter med begränsade möjligheter till egen produktivitetsutveckling. Vi kommer sannolikt också behöva nya skattebaser och är beredda att genom skatt öka den offentliga konsumtionen på bekostnad av den privata när det är nödvändigt för att trygga välfärden och samhällstryggheten. ........................¬ Sveriges näringsliv bygger till stor del sin konkurrenskraft på ett högt kunskapsinnehåll, kompetenta medarbetare, välfungerande trygghetssystem och en väl utbyggd infrastruktur. På många områden ligger Sverige i forskningsfronten och flera svenska företag är världsledande. I näringslivet pågår en ständig omställning. En del företag och arbetstillfällen försvinner, medan nya kommer till. Många svenska företag har kommit långt inom miljöteknik och när det gäller att presentera hållbara lösningar. För att understödja detta vill vi göra framtidsinvesteringar i utbildning, forskning, kompetensförsörjning och kommersiali- sering av innovationer. Ett ansvarstagande och kreativt näringsliv och entreprenörskap är viktigt för att utveckla svensk ekonomi och möta de utmaningar som världen står inför. Vi vill stärka möjligheterna för människor med goda idéer att starta och driva företag. På så vis kan många nya jobb växa fram. Samhället bör stödja framväxten och utvecklingen av dessa mindre företag. Hjälp med rådgivning och kapitalförsörjning i tidigt skede i företagandet är jämte lägre arbetsgivaravgifter och slopat eller minskat sjuklöneansvar viktiga reformer för ökat företagande. Steget från idé och innovation till prototyp, produkt och kommersialisering måste bli kortare. En viktig del av framtiden för svenskt näringsliv ligger i den gröna omställningen, som ställer nya krav på kompetens och arbetssätt. Vi ser positivt på öppen källkod och öppen hårdvara som ett sätt att stimulera kreativitet, företagande och jobbskapande. Näringslivet ska ges långsiktiga spelregler som skapar stabila förutsättningar för investeringar. Företagare ska kunna känna trygghet i att energieffektivisering och miljöanpassning kommer att löna sig i längden. Vi vill underlätta för svenskt näringsliv att ställa om sin produktion till att bli långsiktigt hållbar och fortsatt konkurrenskraftig. Vi vill se nya företagsformer inom den sociala ekonomin. Kooperativ och lokala företagsfonder är ett sätt att låta närsamhället ta del i den framväxande ekonomin. Vi vill också främja nya bolagsformer där syftet inte bara handlar om ekonomiska mål utan också om att gynna allmänna intressen. Könskvotering till bolagsstyrelser behövs för att uppnå jämställdhet. Det allmänna och näringslivet har i grunden olika roller. I vissa fall kan det dock finnas skäl för staten eller en kommun att äga och driva affärsverksamheter. I de företag där det allmänna är hel- eller delägare ska ägarskapet vara aktivt och inflytandet användas för att främja exempelvis hållbarhet och jämställdhet. Statliga pensions-fonder ska ställa etik- och miljökrav på de företag de investerar i. Onödig byråkrati ska undvikas genom ett aktivt regelförenklingsarbete. Monopol- och kartellbildningar ska motverkas för att skapa fungerande marknader. Vi vill se stora satsningar på järnväg, bostäder, energieffektivisering och förnybar energi som kommer att förbättra förutsättningarna för svensk industri att leverera gröna varor och tjänster och vara globalt konkurrenskraftig. ...................... ....; Arbetsmarknadspolitiken ska verka för en väl fungerande arbetsmarknad i hela landet. I det arbetet spelar utbildningspolitiken och den ekonomiska politiken en viktig roll. Arbetsmarknaden behöver bli bättre på att matcha arbetsgivare och arbetstagare. 20 Vi värnar den svenska modellen där arbetsmarkna- dens parter gemensamt förhandlar fram vad som ska gälla på arbetsmarknaden genom kollektivavtal. Modellen bygger på att en hög andel av arbetstagarna är fackföreningsanslutna, och den fackliga organiseringen bör uppmuntras. Vår politik ska ge alla människor möjlighet att efter sina förutsättningar genom arbete bidra till samhället. Vi vill värna en fungerande arbetsrätt och ge arbetstagare inflytande över både arbetets innehåll och arbetstiden. Arbetstagare ska ha goda utvecklingsmöjligheter och känna sig delaktiga, trygga och respekterade. Alla har rätt till friskvård och en god fysisk och psykosocial arbetsmiljö. Arbetstagare har i dag väldigt olika arbetsvillkor och arbetstider, och skillnaderna ökar. På den del av arbetsmarknaden där arbetstagarna ofta har svag anknytning och få rättigheter är inflytandet mycket litet. Där finns de som alltid behöver vara tillgängliga och som förväntas att utan ersättning arbeta mer än vad avtalen anger. Vi kan se att detta sliter ut många, och att en del, däribland många unga, ställs helt utan möjlighet att komma tillbaka till arbetsmarknaden. Deras arbetsvillkor måste förbättras. Diskriminering drabbar inte bara individen, utan är också kostsam för samhället. Den strukturella diskrimineringen finns på alla områden i arbetslivet, när det gäller lön, anställningsformer och arbetstid. Jämställda löner och ekonomisk självständighet är viktigt för att öka jämställdheten mellan kvinnor och män. Det är också viktigt att åstadkomma rimliga arbetsvillkor och trygga anställningsformer i det som i dag är kvinnodominerade branscher. Anställda inom offentligt finansierad verksamhet ska ha rätt till heltid med möjligheten att gå ner till deltid. Sverige är ett av världens mest jämställda länder menharfortfarande enkönssegregerad arbetsmarknad. Vi måste aktivt arbeta för att människor ska välja yrken fritt oavsett könsnormer för att bryta denna segregering. Kvinnor arbetar oftare deltid och obetalt i hemmet med barnomsorg eller vård av föräldrar. Offentligt finansierad barnomsorg och äldrevård är därför viktigt för jämställdheten och kvinnors makt över sina liv och sin tid. Barnomsorg ska finnas tillgänglig även för de barn vars vårdnadshavare arbetar kvällar, helger eller nätter. Medan många i dag har osäkra arbetsförhållanden eller helt stängs ute från möjligheten till arbete och egen försörjning, finns det många andra som arbetar så mycket att det leder till stress och förslitning. Balansen mellan arbete och fritid är för många en fråga om livskvalitet. Vår vision är ett arbetsliv som präglas av en hälsosam balans mellan arbete och fritid. En viktig reform är att sänka arbetstiden. I ett första steg har vi som målsättning att sänka normalarbetstiden till 35 timmar per vecka. Hela samhället tjänar på att människor orkar och vill arbeta fram till pensionen utan att slås ut på grund av stress eller för hårda arbetsvillkor. ................W Desenasteseklerna avekonomiskutvecklinghar möjliggjortsgenomtillgångenpåbillig energii form avkoloch oljasomharorsakat storautsläpp av växthusgaser.Klimat-och miljöförändringarna ochdenyaformernaförutvinning avfossilgas och oljainnebär att världen stårinför enorma utmaningarochbehov avinternationellaöverenskommelserför attsluta utvinnafossila energislag. Övergångentillenlångsiktigthållbar ekonomi handlaristor utsträckningomhur en omställning avenergisystemet och ekonominkring denna ser ut. Med en framtidsinriktad energipolitik är det möjligt att klara energiförsörjningen helt utan fossila bränslen och kärnkraft. En sådan energi. politik vilar på tre ben: dels måste vi använda energin mycket effektivare än vad som sker i Sverige i dag, dels ska vi minska våra krav på energikrävande standard och dels måste produktionen av förnybar energi öka så att andelen blir hundra procent. Energislöseriet är i dag omfattande. Det finns stora 21 potentialer att utnyttja energin effektivare i fordon, lokaler och bostäder och industri, och det är dessutom lönsamt. Möjligheterna att använda förnybar energi är i Sverige mycket goda. Vi lever i ett land med naturliga förutsättningar för att utveckla vindkraft, vågkraft och solenergi. Bara en liten del av potentialen är än så länge utnyttjad. Sverige ska vara en viktig producent av biobränsle, både för uppvärmning och för att framställa drivmedel till fordon. Miljökrav på utformning och lokalisering ska ställas även på förnybar energi. Vattenkraften är enligt vårt sätt att se det färdigutbyggd och därför ska de sista orörda älvarna och strömmande vattnen skyddas. Däremot vill vi främja ombyggnad och effektivisering av befintliga vattenkraftverk samtidigt som ökade miljökrav säkrar fiskens möjlighet till vandring. Kärnkraft bygger på ytterst miljöstörande brytning av uran, en ändlig naturresurs, och leder till att radioaktivt avfall överlämnas till kommande generationer att hantera. Kärnkraften innebär också stora risker vid såväl uranbrytning som drift av reaktorerna och transporter av bränsle och avfall. Den civila kärnkraften möjliggör dessutom produktion av kärnvapen. Kärnkraften hör därför inte hemma i ett hållbart samhälle. Vi motsätter oss byggandet av nya reaktorer i Sverige, eller effekthöjning i befintliga, och vill i stället påbörja avvecklingen av kärnkraften omedelbart. Politik behövs för att främja den gröna energiomställningen. Hit hör ekonomiska styrmedel som energi- och koldioxidskatter, men också invest- eringar i energieffektivisering, bland annat genom upprustning av miljonprogrammets bostadsområden och skolor. Samhället ska stödja energirådgivning till företag och enskilda. Det behövs både planeringsmål, förenklade regelverk och ekonomiskt stöd för att främja de förnybara energislagen, utveckla smarta elnät och stimulera fler människor till att producera sin egen värme och el. Världensberoendeavolja,kolochgasärdestruktivt förmiljön.Detbidrardessutomtillen instabil världsekonomimedstoraprisvariationerochtill betydandekonflikt-ochsäkerhetsrisker.Görviinte enomställningnuunderordnadeformerkommer resursbristenatttvingaframenförändringsenare, mentillbetydligthögrekostnadförbådeenskilda medborgare,företagochhelanationer. .......................... Ett väl fungerande transportsystem är nödvändigt för att människor och gods ska kunna förflytta sig och transporteras på ett smidigt, säkert och samtidigt miljöanpassat sätt. Transportsektorn är i dag Sveriges största användare av fossila bränslen och såväl struktur- som teknikförändringar är därför nödvändiga för att nå långsiktig hållbarhet. Vi vill minska behovet av transporter. Det kan bland annat göras genom god samhällsplanering som för bostäder, arbetsplatser och service närmare varandra, och genom digital kommunikation, distansarbete och klimatsmarta logistiksystem. De transporter som ändå behöver utföras ska ske med trafikslag, fordon och drivmedel som har liten miljöpåverkan samtidigt som en hög trafikstandard och trafiksäkerhet upprätthålls. Klimatskadliga investeringar som ökar privatbilism och lastbilstrafik ska väljas bort till förmån för ökade järnvägsinvesteringar. Bilen är ett transportmedel som har inneburit ökad rörlighet för många. Bilen kommer att finnas kvar och tjäna människor i deras vardag under överskådlig tid. Bilismens problem behöver lösas. Biltrafikens problem är inte bara trafikolyckorna och klimatpåverkan. Privatbilism är ofta ett ineffektivt sätt att transportera människor, särskilt i storstäderna. Den kräver stort utrymme och hög energianvändning. Biltrafiken bidrar också till övergödning, försurning, störda ekosystem och marknära ozon. Barn drabbas särskilt hårt av lokala bilavgaser i städerna, där biltrafiken också kräver mycket utrymme och för med sig stora problem med buller. En del av de problemen kan lösas med övergång till andra drivmedel, men även tillgången till biodrivmedel är och kommer att vara begränsad. 22 När det gäller persontransporter i stads- och tätortsmiljö vill vi att samhället ska prioritera en väl utbyggd kollektivtrafik och gång- och cykeltrafik. I stadsmiljö kan detta ersätta en stor del av biltrafiken. Vi ser gärna att spårtrafiken ökar. För att främja en sådan utveckling vill vi anpassa både regelverk och infrastruktur till de prioriterade trafikslagens behov och förutsättningar. Exempel på sådan infrastruktur är smidiga kollektivtrafik- system, cykelbanor, laddstolpar och hyr- och lånesystem för bilar och cyklar. Nödvändiga biltransporter ska ske med förnybara bränslen. Olika delar av Sverige har olika förutsättningar för såväl person- som godstransporter, och Miljöpartiet inser behovet av delvis olika lösningar för stad och land. På landsbygden kommer i många fall bilen fortfarande att vara huvudalternativet för lokala transporter, och därför ska det finnas bränslesnålare bilar och också en väl utbyggd infrastruktur för förnybara bränslen. Vi vill även se en utbyggnad av gång- och cykelvägar mellan tätorter på lands- bygden. God närservice, informationsteknik, samåkningssystem, bilpooler och flexibla kollektivtrafiklösningar är viktiga komplement. För långväga persontransporter är järnvägen det miljövänliga huvudalternativet. De olika tågbolagen måste samordna taxor, biljettbeställning och tidtabeller för att bli mer konsumentvänliga. Det gäller även de europeiska tågbolagen. Vi vill att det ska vara lätt att resa med tåg över hela Europa. Man ska kunna lita på järnvägen. Därför måste spåren underhållas och förseningar minimeras. Flygetäridagettavvårasämstaresalternativför miljön, setttill utsläppperperson ochkilometer. Samtidigtfinnsfåalternativför delångväga resorna.Detärför oss självklartattflygetskabära sina miljökostnaderfullt ut.Flygbolagen ska betalaförflygbränslets negativa miljöpåverkan genombränsle-ochkoldioxidskatter.Flygplatser skainte subventioneras med offentliga medel. InomlandetochEuropa villvibygga utsnabba tågförbindelser som ska erbjudabilligare och bekvämare resoränflyget.Digitalalösningarkan också erbjuda alternativtill många arbetsresor somidaggörs medflyg. Sverige har en lång kust med väl fungerande hamnar som ger goda förutsättningar att förbättra energieffektiviteten genom att kombinera land och sjötransporter. Godstransporter ska så långt som möjligt utföras med miljöanpassade och energieffektiva transportmedel. Vi vill bygga ut och utveckla järnväg, sjöfart och kombiterminaler så att godstransporter på väg kan minska. För att stimulera den här utvecklingen inom trans- portområdet behövs många olika slags styrmedel. Samhället måste själv styra och stå för utbyggnad av infrastruktursystemen. Kollektivtrafiken och järnvägsnätet behöver byggas ut kraftigt och förbättras för både personer och gods i hela landet. Järnvägssystemetbehöversesöverochtillvissa delaråterreglerasförattfåettoptimaltochlångsiktigtfungerandetransportsystem. Villkorenföratt bedrivaattraktivtrafikidessasystemskavaragoda. Lagar och ekonomiska styrmedel ska användas för att främja fordon och drivmedel som klarar klimat- och hälsomålen. De ekonomiska styrmedlen bör vara en kombination av åtgärder som gör mer miljövänliga alternativ billigare och de miljöskadliga dyrare att använda. 23 ......................s Välfärden ska ge människan frihet och trygghet. Vi är som starkast när vi vet att vi lovat att ta hand om varandra när vi är som bräckligast. Därför vill vi ha goda välfärdsinstitutioner som tillhandahåller vård och omsorg när vi behöver det och trygghetssystem som stöder den som är sjuk eller utan arbete. Välfärden är något som vi alla såväl finansierar som formar. Historien om hur den moderna välfärdsstaten växte fram är också en berättelse om frihet. I början av 1900-talet handlade människors kamp om demo- krati, fackliga rättigheter, rimliga arbetsvillkor och ekonomisk trygghet. Från den tiden bär vi med oss insikten att verklig frihet förutsätter en fungerande välfärd. Nu är utmaningen att bygga frihet och trygghet för dagens och morgondagens förhållanden. Välfärdsstatens trygghetssystem måste vara inkluderande, generella och robusta. Alla har rätt till ekonomisk trygghet. Samhällets tjänster ska hålla en hög kvalitet och vara tillgängliga för alla. Ett jämlikt samhälle är tryggare för alla invånare. Därför vill vi motverka ekonomisk ojämlikhet. Även den som är arbetslös eller sjuk ska kunna vara delaktig i samhället. Detär rimligtattden somhar detgott ställt ekonomisktbidrar mertilldetgemensamma trygghetssystemetän den somhar ettmindre ekonomisktutrymme.Allakommer någongång underlivet attbehöva välfärdenstjänster ochdet gertrygghet att veta att sjukvård, skola,äldreomsorg, barnomsorg, sjukförsäkringoch annan samhällsservicefungerarbra. ............................... Välfärdhandlarintebara omtrygghetutan även omlivskvalitet.Enförutsättningför vår välfärdär enbra miljö medtillgångtill renluft ochrent vatten, något som vioftatarförgivet.För engod livskvalitetkrävs attvikantillfredsställa våra grundläggandebehov.Detkanhandla om attha ettboende vitrivs med, råd attköpagodoch hälsosam matsamtförutsättningarför atthålla ossfriska ochvara delaktigai samhället.För mångainnebär välfärdbland annat enfungerande kollektivtrafikoch möjlighet attlätt och säkert kunna cyklatilljobbet.För andrakan detvara att yrkesarbeta mindreför attiställetfåtidattägna sigåtfrivilligarbete elleråt sinafritidsintressen. Genom att betona livskvalitet sätter man människors behov och önskemål i centrum. Därför vill Miljöpartiet sänka arbetstiden till 35 timmar per vecka i ett första steg. Att värna människors behov av god miljö, gemenskap, uppskattning, meningsfullhet och självförverkligande leder till bättre folkhälsa och tillfredsställelse i vardagen. Sambandetmellan människors materiellalivsvillkor ochlyckaär starktför människor somintefår sinagrundläggandebehovtillgodosedda.Menför människor som redanhar engod materielllevnadsstandardär det oftaintelängreytterligare förbättringari ekonomiska villkor ochkonsumtionsmöjligheter somgerökadlycka ochvälbefinnande. Samhälletsutvecklingmåstestyras av bredare målochmåttpålivskvalitet snarareän traditionellekonomisktillväxt.Miljöpartietde gröna villge sådana måtten centralplatsipolitiken. Detkantillexempelhandla om miljö och 24 hållbarhet,utbildningochkultur, rättstrygghet ochlika rätt,fördelningoch solidariskt ansvarstagande. För många människor i Sverige är i dag tiden den största bristvaran. Många som har blivit rikare på pengar, har samtidigt blivit fattigare på tid. Att kunna ta ut en större del av välstånd, till exempel löneökningar, som kortare arbetstid ska därför underlättas. Ett ökat fokus på livskvalitet som politiskt mål förtar inte behovet av att värna och förbättra de materiella villkoren för människor som har det svårt både i vårt eget land och andra länder. Dessa strävanden kan gå hand i hand genom en politik för jämnare fördelning av människors konsumtionsmöjligheter, både nationellt och internationellt. ............................s Ett fungerande samhälle bygger på välfärd, utveck- ling och högkvalificerade jobb i hela landet. Den snabba urbaniseringen innebär utmaningar för både stad och landsbygd. En levande landsbygd erbjuder attraktiva livsmiljöer med närhet till friluftsliv och rekreation. I en tid av omställning spelar lands- bygden en avgörande roll för utveck-lingen av ett hållbart samhälle genom bland annat satsningar på förnybar energi och lokal matproduktion. Miljöpartietharendecentralistiskgrundsynsom blandannattarsiguttryckiattvivillattregioneroch kommunergesettökatansvarochinflytandeöverde politiskabeslutsomberörregionenochkommunen. Beslutbörtassånäramedborgarnasommöjligt. Samhällsfunktionersompolis,arbetsförmedlingoch försäkringskassaskavaratillförSverigesallainvånareochfinnastillgängligaöverhelalandet. Statliga regelverkskafungeralikabraförsmåkommunersom förstoratillväxtkommuner.Ettvälfungerandeskattesystemskagelikvärdigaekonomiskaförutsättningar attbedrivakommunalserviceihelalandet. En utbyggd och välfungerande infrastruktur är nödvändig för att hela Sverige ska leva. Kollektivtrafik i allmänhet och tågtrafik i synnerhet krävs för att vi ska kunna arbeta och bo även på lands- bygden. Post och telekommunikation, inklusive fast telefoni, av god kvalitet och till rimligt pris behöver också finnas tillgänglig över hela Sverige. Detta ska vara samhällets ansvar. Bredbandsutbyggnad är av avgörande betydelse för en levande landsbygd. Det civila samhället spelar en viktig roll för att hela landetskaleva.Föreningslivochidéburnaorganisationer bidrar till socialt hållbara samhällen och stärkt livskvalitet hos unga och gamla. Vi vill att hela Sverige ska få ta del av ett rikt och levande kulturutbud och ha en god tillgång till utbildning. Kultur bidrar till landsbygdens attraktionskraft och främjar inflyttning och besöksnäring. Därför satsar vi på regional kulturverksamhet som till exempel museer och folkbibliotek. Byskolor, folkhögskolor, regionala högskolor och distansutbildningar är viktiga för möjligheten till utbildning i hela landet. Distansarbete och kultur på distans måste också vara lättillgängliga alternativ, genom bland annat utbyggt, snabbt bredband. Det finns tiotusentals blomstrande småföretag runt om på landsbygden. Småföretag ska ha lägre arbetsgivaravgift och mindre sjuklöneansvar än större företag. Samhället ska kunna bistå med kreditgarantier till landsbygdsföretagare. Investeringar i natur- och kulturmiljövård samt utveckling av modern ekoturism kan ge många gröna jobb. Även energisektorn är en näring av stor vikt för landsbygden. Energieffektivisering, utbyggnad av förnybara energikällor och ny energiteknik kan bidra till ett blomstrande regionalt näringsliv. Vi ser positivt på lokalt ägande varför det måste finnas tillgång till kapital. Skogsbruket och jordbruket är inte bara viktiga för landsbygden utan för hela Sveriges överlevnad. Därför vill vi prioritera åtgärder för landsbygdens miljö och struktur, och stimulera forskning inom miljö, jord- och skogsbruk och ekologisk produktion. Vi värnar också de näringar och arbetstillfällen som våra nationella minoriteter bidrar med. Många på landsbygden är beroende av bilen, även med en utbyggd kollektivtrafik. Det är en ödesfråga 25 för landsbygden att samhället lyckas bryta beroendet av bensin och diesel. Plötsligt stigande oljepriser eller sämre tillgång på olja kommer annars att drabba landsbygden hårt. En del av de nya gröna bränslena kommer också att tillverkas på den svenska landsbygden. Redan i dag förser lands- bygden Sverige med stora mängder av vår förnybara energi, och det finns fortsatt goda förutsättningar för att bygga ut en lönsam och nödvändig energiproduktion. Klimatomställningen ger på så sätt både trygghet för och arbete på landsbygden. ..................s Levande och väl fungerande städer erbjuder goda livsmiljöer med korta avstånd och mångfald i näringsliv, arbetsmarknad, kultur och utbildning. Den snabba urbaniseringen innebär stora utmaningar för många städer, men där finns också goda möjligheter att utveckla gemensamma, effektiva lösningar för många att leva tillsammans. För att möta framtiden och miljöutmaningarna behövs omfattande investeringar i energieffektivisering av befintlig bebyggelse, i kollektivtrafik, klimatanpassning och bättre förvaltning av ekosystemtjänster. Stadsplaneringen ska genomsyras av en helhetssyn som sätter människans och miljöns långsiktiga välmående i centrum. Människor ska ges möjlighet att på ett enkelt och konstruktivt sätt påverka stadens utveckling. Nyproduktion av bostäder ska ses som ett verktyg för att minska segregationen – i dag genomförs i stället nyproduktionen ofta på ett sätt som ökar klyftorna mellan olika delar av stad- en. Den offentliga miljön kring gator och torg ska underlätta möten och kulturella upplevelser. Den gröna staden är en mänsklig, miljövänlig och levande stad med livskvalitet och lika rättigheter för alla. Planering av nya områden ska i första hand ske på redan exploaterad mark. Byggnation ska ske på ett yteffektivt, resurseffektivt och klimatsmart sätt. Bostäder ska byggas där kollektivtrafiken är väl utbyggd och blandas med arbetsplatser, rekreationsområden, idrott, service, kultur, förskolor och skolor. En vision om nollutsläppsstäder behövs där tekni- ska system stöder hållbara livsmönster. Det måste finnas en balans mellan produktion och konsumtion av både energi, mat och produkter. Urban odling och småskalig och lokal elproduktion är viktiga delar i detta. Stadens tak är en stor outnyttjad resurs. Närhet och blandning är viktiga principer för staden. En stadsstruktur där arbete, bostäder och handel blandas och samsas i samma områden ger en levande och trygg stadsmiljö samtidigt som den kan minska behoven av transporter. I många svenska städer och samhällen är förtätning en utvecklingspotential, inte minst för att förstärka nyttan av järnvägsinfrastrukturen. Grönytor är viktiga för både miljön och människors hälsa, fysisk såväl som psykisk. Grönytor måste därför vara en naturlig del av staden. En god stadsplanering underlättar för stadens invånare att göra ekologiskt hållbara val. Människor ska med lätthet kunna röra sig till fots och med cykel och ha tillgång till ett väl utbyggt kollektivtrafiknät. Att bo i staden ska innebära en frihet från att behöva bil. Sophanteringen ska ske på ett sätt som är så bra som möjligt för miljön och återvinning och återanvändning ska främjas. För att skydda människor, hus och samhällsviktiga funktioner mot de översvämningar som skyfall och ihållande regn kan ge upphov till behöver tätorterna mer grönska och öppet vatten. ................................ ........................q Vi vet av att varje centrum i varje stad, nära eller långt från stadskärnan, har potential att ge en god boendemiljö, trygga uppväxtvillkor och livskvalitet. I dag är det inte alltid så. Bostadsområden, särskilt sådanabyggdaunderdetsåkallademiljonprogramm- et, har tillåtits att förfalla och närservice har utarmats. Det har lett till negativa och nedbrytande attityder gentemot flera stadsdelar och förorter, som har 26 spätt på segregationen. Vi vill ändra på detta genom en bra välfärd, en klok bostadspolitik där hyresrätten värnas och upplåtelseformer blandas samt genom investeringar. Miljonprogrammet står inför en stor klimatupprustning. Denna ska ses som en samhällelig invest- ering, och inte enbart bäras genom hyreshöjningar i områden där många har låg inkomst. När vi gör investeringen ska vi också erbjuda vägar till yrkesutbildning och arbete och se till att bygga områdena på ett sådant sätt att goda mötesplatser för barn och vuxna skapas. De boende ska inte bara involve- ras i upprustningen, utan i stor utsträckning plan- era och genomföra den. Ekonomin utanför stadskärnorna byggs ofta upp av småföretag. Satsningar som gör det billigare och enklare att starta företag och att anställa är därför satsningar som kommer förorter till del. Vi vill främja ett starkt föreningsliv och självorganisering i varje stadscentrum. Det görs bland annat genom tillgång till kultur, som folkbibliotek och möteslokaler. Vi tror också att det finns ett behov av nya folkhögskolor i Sverige, inte minst i miljonprogrammets områden. Det ska inte finnas några områden i Sverige där de boende upplever att man måste flytta för att få en chans. Alla ska ha rätt att trivas och utvecklas där man bor. ............................................å Sverige ska ha en hälsofrämjande, jämlik och modern hälso- och sjukvård. Vården ska hålla god kvalitet, vara tillgänglig, fördelas efter behov och vara solidariskt finansierad. Tandvården ska ha samma villkor som övrig vård och ska därför vara en del av den offentligt finansierade vården och ingå i ett gemensamt högkostnadsskydd. I dag är tillgången till vård ojämnt fördelad. För oss i Miljöpartiet de gröna är det självklart att ett genus- och jämlikhetsperspektiv ska genomsyra all vård och omsorg. Likvärdig vård oberoende av kön och socioekonomiska faktorer borde vara en själv klarhet. Kvinnor får ofta vänta längre på viktiga behandlingar och har sämre tillgång till speciellt dyra behandlingsmetoder. Detta kan exempelvis göras genom högre grad av uppsökande verksamhet inom primärvården. Primärvården ska utvecklas och är basen i vården. Papperslösa och asylsökande ska ha rätt till vård. Sjukvården bör vara avgiftsfri för barn upp till 18 års ålder. Patientens självbestämmande och delaktighet är en allt viktigare del av hälso- och sjukvården. Patient- en ska ha rätt till insyn i och inflytande över sin journal. Digitala tjänster inom vården ska utveck- las. Vi vill att vården ska ha en helhetssyn på patienten där man tar hänsyn till både kroppsliga och psykiska symtom samt patientens livssituation. Målet ska alltid vara att i första hand behandla sjukdomsorsak och inte symtom. De svårast sjuka ska få vård snabbt. Vårdgarantier bör därför utgå från medicinska behov och ersättningarna i sjukvården baseras på patienternas vårdtyngd, så att inte friska människor prioriteras framför kroniskt sjuka. Alla har rätt till en individuell vård med en tvärprofessionellt utformad vård- plan utifrån olika perspektiv. Vi vill se en utvecklad vård i livets slutskede med god omvårdnad och tillräcklig smärtlindring, i en miljö som är bra både för patienten och för hens anhöriga. Sveriges befolkning blir allt äldre. Den demo- grafiska utvecklingen ställer nya krav på vården och kommer att tvinga fram en ökad samordning mellan olika vårdformer, till exempel mellan primärvård och äldreomsorg. Vi menar att en långsiktig satsning på folkhälsa med fokus på människors livsvillkor är lika viktig som sjukvården för att främja god hälsa. Vi vill därför se ett nationellt folkhälsoprogram och stödja kommuner och landsting i deras hälsofrämjande arbete. Köerna i vården ska minska och tillgängligheten ska öka. Miljöpartiet vill också att arbetet med att använda alternativ till läkemedel, exempelvis motion på recept och psykoterapi, fortsätter att utvecklas då läkemedelskonsumtionen i dag är ett problem både för patientsäkerheten och miljön. Det är även 27 viktigt att uppmuntra ett internationellt perspektiv i hälso- och läkemedelsfrågor, som till exempel antibiotikaresistens. Personer med beroende- och missbruksproblematik har precis som alla andra invånare i Sverige rätt till bästa möjliga vård. Det ska finnas god tillgång till behandling mot beroende och missbruk i hela landet. Missbrukspolitiken bör utgå från de metoder som forskningen visat vara mest effektiva för att lindra skadeverkningarna av missbruk och beroende, både för samhället och för individen Förebyggande arbete ska premieras. Alla som har behov av det ska i ett tidigt skede erbjudas verksam behandling för att kunna bryta sitt missbruk. En av grundprinciperna i vården är att ingen patient ska komma till skada. Sjukvårdens utförare behöver fortsätta arbetet med att förbättra patient- säkerheten. Personal inom vården ska precis som i all annan offentligfinansierad verksamhet ha meddelarfrihet och meddelarskydd, för att de tryggt ska kunna uppmärksamma brister i vården. Vi vill uppmuntra att sjuksköterskor, psykologer, sjukgymnaster och andra legitimerade yrkeskategorier får möjlighet att ta ökat ansvar för sina patienter, så att deras kompetens utnyttjas bättre. Vid besök i vården ska alla som har behov av det garanteras kvalificerad tolk. Patientnämndernas och patientföreningarnas roll i förbättringar av vården bör utvecklas och stärkas. Denpsykiska ohälsan växer,ochledertill stort lidande.Miljöpartietser attviiSverige måste arbetalångt mer målinriktatmedhälsofrämjande och sjukdomsförebyggandeinsatser.Förbarn och ungakrävs det en aktiv samverkan mellan elev- hälsa,föräldrar,primärvård, ungdomsmottagning ochpsykiatri.Till skillnadfrånkroppsliga sjukdomarärpsykiskohälsa ofta stigmatiserande och många skämsför att söka vård.Dettabör mot- verkasgenom attitydförändringar ochgenom att erbjudabehandling avgodkvalitetietttidigt skede.Denpsykiatriska ochpsykologiskakompetenseniprimärvården ska vara starkoch kvalitetssäkrad. Godsexualundervisningiskolan,tillgängligaungdomsmottagningarochtillgångtillpreventivmedel skasäkraengodsexuellochreproduktivhälsa. Sverigeskaarbetaaktivtglobaltförmöjlighettill familjeplanering,sexuellarättigheterochreproduktivhälsa. Miljöpartietvärnarkvinnorsrätttillabort. Vi är positiva till att människor tar ett större ansvar för sin vård och vill att sjukvården är lyhörd för vilka vägar individen söker finna för bättre hälsa. Det är viktigt att behandlande läkare har kunskap om hela patientens sjukdomsbild och behandling för att kunna ge en patientsäker vård. För att öka kunskapen och förståelsen för komplementär medicin bör sjukvårdspersonal inom den offentliga vården ha möjlighet till utbildning om komplementär behandling. Vi vill stärka patientens rättigheter och satsa mer på hälsofrämjande vård. Den offentligt finansierade sjukvården ska dock inte uppmuntraellerstödjaenpatientattanvändasigavmetoder som saknar vetenskapligt stöd. Den vård som bedrivs av ideella krafter bör tillvaratas och uppmuntras. Landstingens möjligheter att skriva direktavtal med idéburna organisationer ska vara goda. Patientföreningar och andra ideella organisationer bör ses som tillgångar för vården och stöttas i bred bemärkelse. Också enskilda patienter har kunskaper, erfarenheter och förmågor som kan användas för planering, utförande och utvärdering av vården. ..................; Alla har rätt till en bostad. I Sverige är tillgången till bostäder ojämnt fördelad mellan människor och över landet. Vissa kommuner har brist medan andra präglas av överskott. Men frågan om bostadsbrist handlar inte bara om brist på ett antal bostäder på ett givet ställe. Minst lika viktigt är att det finns bostäder för alla oavsett socioekonomisk situation eller eventuella funktionsnedsättningar. Miljöpartiets bostadspolitik ska motverka segregation och främja lika rättigheter. En fungerande bostadspolitik måste omfatta åtgärder på såväl nationell som lokal nivå. Vi behöver se till att det byggs bostäder som efterfrågas av unga, studenter, äldre, stora familjer och låginkomsttagare. 28 FörossiMiljöpartietärbostadspolitiksamhällsbyggnad. Genom att bygga med resurseffektiv teknik kan man skapa moderna och attraktiva bostadsområden. Vi vill utnyttja marken bättre genom att bygga både på bredden och höjden och på ytor som i dag inte används optimalt. Vi vill premiera mångfald, vilket minskar risken för boendesegregation och skapar ett mer levande samhälle. Kultur- och naturvärden ska värnas och lyftas fram. Olika boendeformer bör blandas och finnas till- gängliga i alla områden. Den höga ombildningstakten från hyresrätt till bostadsrätt i storstadsområdena har ställt till stora problem. Nya mod- eller för hyressättning har också inneburit svårigheter för människor att finna en bostad. Därför är det särskilt viktigt att värna hyresrätten och en reglering av hyresmarknaden. Villkorenförupprustningaväldrebostadsområden skavaragoda.Deninremiljönärviktigattuppmärksamma, exempelvis inomhusmiljön i bostäder och på arbetsplatser. Ettbostadsområdeärmeränbara lägenhetenmanboriochdetärävenviktigtmeden kreativutemiljö,därdetfinnsplatsförlek,gemenskapochrekreation. Detärsärskiltviktigtattmiljonprogrammets bostäder och skolor blir upprustade. Det befintliga beståndet av bostäder kan utnyttjas mycket mer effektivt genom att vi underlättar flyttkedjor och skapar en tryggare andrahandsmarknad. Byggmarknaden måste fungera på ett tillfredställande sätt. Vi vill främja konkurrensen i byggsektorn genom att ge små och medelstora byggföretag goda förutsättningar att delta. Markna- dens spelregler måste dessutom vara tydliga och likvärdiga och präglas av långsiktighet. Satsningar på kollektivtrafik är en viktig faktor för att göra fler områden mer attraktiva att bo och leva i. ........? ........... ................... Alla har rätt till grundläggande ekonomisk trygghet. Samhällets skyddsnät måste förbättras så att ingen faller igenom. Vår vision är att alla som saknar inkomst ska vara garanterade ett stöd som går att leva på, oavsett vilken inkomst man har haft tidigare och oavsett orsaken till att man saknar inkomst. Samhällets ekonomiska trygghetssystem omfördelar inkomster mellan olika perioder i en människas liv. Det fungerar när man av olika skäl, som till exempel funktionsnedsättning, sjukdom eller arbetslöshet, för en kortare eller längre tid inte kan försörja sig själv. Ett trygghetssystem som ger alla stöd och hjälp ger också alla modet att våga göra nya saker genom livet. Det ökar också benägenheten att bidra och känna ansvar för samhällets gemensamma utmaningar. För barnfamiljer behövs både generella stöd som barnbidrag och föräldraförsäkring och behovsinriktade stöd som bostadsbidrag och underhållsstöd. Det är viktigt att behovsprövningar inte blir integritetskränkande. För Miljöpartiet de gröna är det särskilt angeläget att värna barn i ekonomiskt utsatta familjer. Studiemedelssystemet ska ge möjlighet för alla unga att bedriva högre studier oavsett föräldrarnas ekonomi. Det ska också främja ett livslångt lärande för äldre studenter. De sociala trygghetssystemen måste fungera också för studenter som blir sjuka eller får barn. Studenter ska kunna studera utan att behöva arbeta under studietiden. Vi värnar en god allmän pension. Under de senaste decennierna har medellivslängden ökat markant. För de flesta innebär ett längre liv också fler år i god hälsa och i realiteten också fler år då man kan och ofta vill vara kvar i arbete. Detta är dock inte en entydig utveckling, skillnaderna på arbetsmarknaden är stora. I många arbeten når den reella genomsnittliga pensionsåldern inte ens upp till 65 år, och arbetstagare upplever försämrad hälsa redan innan pensionen. Politik för ett mänskligt arbetsliv är därför samhällsekonomiskt viktigt. Pensionsåldern bör vara mer flexibel, och rätten att ha kvar sitt arbete även efter 67 års ålder bör stärkas. Regelverken i dagens pensionssystem, såsom bromsen, premiepensionen och skattenivån, behöver analyseras så att pensionssystemet är långsiktigt hållbart och främjar jämställdhet och jämlikhet. Pensionsmedlen ska placeras etiskt och långsiktigt hållbart. Vi verkar för en gemensam arbetslivstrygghet för människor i yrkesverksam ålder. Vi vill se en 29 samlad allmän försäkring som gäller vid både sjukdom och arbetslöshet, med harmoniserade villkor så långt som det är möjligt. För att undvika att individer med en sammansatt problembild bollas runt mellan många olika myndigheter ska den samlade försäkringen administreras av en myndighet enligt principen ”En dörr in”. Alla som är beredda att ta arbete och efter sina förutsättningar bidra till sin försörjning ska ha del av en arbetslivstrygghet. Samhället ska aktivt stödja individens möjligheter till arbete exempelvis genom åtgärder för rehabilitering och utbildning. Försäkringen ska vara bred, ha låga trösklar för inträde, och i tillämpliga delar även omfatta studenter och egna företagare. Människor som på grund av svårare sjukdom eller funktionsnedsättning långvarigt eller livslångt inte kan försörja sig själva ska ha rätt till ekonomisk och personellt stöd från samhället. Vi värnar assistansreformen som möjliggör ett tillgängligt liv för den som har en funktionsnedsättning. Prövning av om någon är assistansberättigad får inte kränka den enskilde, och systemet behöver en långsiktigt trygg finansiering. ................................................ô Välfärdstjänsterinom vård,skola och omsorg ska erbjudas alla människorpålika villkor ochefter behov.Vidfördelningavsamhälletsresursertill olika områden skahänsyntastillattbehovenkan se olika ut.Detkantill exempel skegenom olika former avsocioekonomiskviktning.Vid utformningen avvälfärdenstjänsterskaresurserna använ-das så atttjänsternaharhögkvalitet och utförs medhöga sociala, ekologiska och ekonomiskakrav. Välfärdens verksamheterfårintehant- eras som vilken marknad somhelst.Viärinte konsumenteriförhållandetillvälfärden, viär medborgare. Under senare år har människor fått ett ökat inflytande över välfärdstjänsterna genom olika slags valfrihetsreformer. Miljöpartiet ser att kommersialiseringen av välfärden motverkar den mångfald som var avsikten med reformerna. Vi tar allvarligt på problemen i skolor och vårdinrättningar där vinstintresset leder till besparingar som drabbat elever och patienter. Vi är också oroade att verklig kvalitetsutveckling hindras till förmån för fokus på rapporterbara prestationer och mätpunkter som kan räknas om i pengar i ersättningssystemen. Vi vill därför få bort de kommersiellt inriktade aktörerna och i stället främja idéburna verksamheter inom välfärdssektorn. Det som är viktigt är kvaliteten på välfärden, att skattemedel används till den verksamhet de är avsedda för samt att de som arbetar inom välfärden har en god arbetsmiljö. Vi tar även ställning för brukarinflytande och insyn oavsett driftsform. All offentligfinansierad välfärd oavsett utförare ska hålla hög kvalitet. Vid upphandlingar av tjänster ska kvalitet vara högt värderat. I upphandlingar ska krav ställas vad gäller miljö, sociala villkor samt arbetsmiljö. Kvaliteten ska ständigt följas upp med olika slags verktyg. All verksamhet ska vara under- ställd tillsyn av en offentlig myndighet som ytterst skakunnastoppaverksamhetsom intehållermåttet. Meddelarfrihet och offentlighetsprincipen ska gälla alla offentligt finansierade välfärdstjänster. Vi vill stärka människors möjlighet att på riktigt välja en välfärd som passar dem, men också ge alla förutsättningar att bidra genom egna initiativ. Att involvera medborgarna i utformandet och leverans- en av välfärdstjänster leder till bättre resultat, högre kvalitet, ökad självkänsla för individen och sänkta kostnader för det offentliga. Verklig valfrihet kräver att information om valmöjligheterna är bra och lättillgänglig. Det kräver också att möjligheten att inte välja finns: den som inte gör ett aktivt val ska ges ett fullgott, högkvalitativt alternativ. Alla utförare inom välfärden ska ha som främsta motiv att bedriva en högkvalitativ verksamhet, och drivas av ett socialt och samhälleligt engagemang. Syftet med verksamheten ska inte vara att dela ut vinst, vilket också ska framgå av stadgar eller bolagsordning. Eventuell vinst ska återinvesteras i verksamheten. Upplägg som innebär för hög skuldsättning eller orimligt höga ränteutbetalningar, eventuellt också via så kallade skatteparadis, ska stoppas. Verksamheternas ekonomi ska 30 redovisas öppet. Vid offentliga upphandlingar ska miljö- och kvalitetsaspekterna viktas betydligt tyngre än i dag. Storskaliga strukturer inom privat och offentlig verksamhet kan lätt bli alltför centralstyrda vilket kan hämma kreativiteten och arbetsglädjen. Därför vill vi verka för decentralisering och stärka arbetstagarnas inflytande på sin arbetsplats. Universitetssjukhus ska fortsatt drivas i offentlig regi. Människornas engagemang och obetalda insatser inom ramen för det som brukar kallas den inform- ella ekonomin, frivilligsektorn eller det civila samhället har en stor, på vissa områden mycket stor, betydelse för vår gemensamma välfärd. Politiken bör på olika vis synliggöra, stödja och uppmuntra sådana insatser. Vi vill främja sociala företag, andra alternativa driftsformer och idéburna organisationer. Frivilligsektorn är till stor del självorganiserad och kan, främst på det lokala planet, stödja och bidra till ökad stabilitet i olika initiativ. Offentliga organ ska aktivt ta del av frivilligsektorns förslag och erbjuda organisatoriskt stöd till frivilligcentraler. 31 ..................s Människanharalltidsträvatefterattsjälvfåstyrasitt livochsinasamhällen.Människorharimoderntid frigjortsigfrånkolonialismensbojor,solidaritetsarbeteharbidragittillattbefrialänderfrånapartheid ochrasförtryckochfolkligaresningarharsänt diktatorerpåflykt.ISverigehardetinteensgått hundraårsedanallmänochlikarösträttinfördes. Mångaharfåttdetbättre.Välståndetbreder ut sig, medellivslängdenökar ochbarnadödligheten minskar.Materiellt setthåller många människor i det somtidigarebeskrivits som utvecklingsländer påatt resa sigurfattigdomen.Samtidigt möter vi nyautmaningariform avöverutnyttjadenaturresurser och miljöhot.Svält ochförtryckär fortfarandeenrealitetförmånga.Merparten av världensfattiga och mest utsattaärkvinnor och barn ochdetär ocksåkvinnor ochbarn som drabbashårdastvidnaturkatastrofer eller väpnade konflikter. Den gröna rörelsen strävar efter att alltid lägga ett globalt perspektiv på politiken. Miljöpartiet de gröna strävar efter en värld i balans där solidaritet och respekt för mänskliga rättigheter kombineras med hållbar utveckling och klimaträttvisa över hela jordklotet. Inom den gröna rörelsen finns ett brett stöd för uppfattningen att vi måste stärka det inter- nationella samarbetet kring miljö, fred och utveck- ling och samtidigt finna sätt att demokratisera den globala ekonomin. Vår viktigaste uppgift är att rätt och rättvist förvalta våra gemensamma naturresurser. När den biologiska mångfalden minskar och klimatförändringarna ökar kommer det främst drabba människor som lever i fattigdom. Redan i dag är kampen om naturresurser en av orsakerna till krig och våldsamma konflikter. Den gröna rörelsens uppgift är att finna vägar så att fler människor i världen kan ta del av välstånd, samtidigt som vi möter klimat- och miljöutmaningarna. ...................................... ................@ Principen om rättvist resurs- och miljöutrymme ska ligga till grund för arbetet med att säkra en värld i fred och välstånd. Världens resurser fördelas och utnyttjas i dag orättvist. På resan in i det tjugoförsta århundradet måste Sverige och andra rika länder kraftigt minska sina ekologiska fotavtryck. Jordens fattiga måste få ta en större del av utrymmet för att kunna lyfta sina länder till en anständig levnads-nivå, utan att behöva kopiera de rika ländernas misstag. Miljöpartiet de gröna vill se ett starkt internationellt samarbete med FN som central aktör för fred och mänskliga rättigheter. Vi arbetar för ett FN som har handlingskraft att fullfölja sina uppgifter. De rika resursstarka ländernas dominans i FN- systemet måste brytas och de ekonomiskt svaga länderna måste ges en starkare röst. Beslutsfattandet i FN ska reformeras, särskilt i säkerhetsrådet vars sammansättning behöver förändras. Systemet med allmän vetorätt för vissa länder bör omprövas. Samtidigt vill vi öka transparensen och ge ickestatliga organisationer större tyngd i FN-systemet. ....................... ................s Miljöpartiet de gröna förespråkar decentralisering. Det innebär att vi vill att beslut ska fattas så nära de människor som berörs av besluten som möjligt. Makt ska utövas av dem som påverkas av den. 32 Denna övertygelse har gett oss en grundläggande skepsis mot centralstyrning och beslut som flyttar makt längre ifrån människor. Vi är varma anhängare av internationellt samarbete. Vi vill se Europa som en del av en värld av demokratier där människor rör sig fritt över gränserna, och där folk och länder handlar och samarbetar med varandra. Vi är positiva till mellanstatliga samarbeten där länder deltar frivilligt i beslut- en. I frågor av global karaktär finns starka skäl som talar för också överstatliga beslut. Det gäller bland annat gränsöverskridande miljöfrågor och skydd av grundläggande mänskliga rättigheter. I dag är EU ett viktigt forum för detta i vår del av världen. Vi gröna arbetar aktivt för att förändra och förbättra EU:s politik. Det krävs radikala förändringar för att unionens politik för miljö och resurshantering ska rymmas inom de gränser som miljön sätter. De obegränsade globala kapitalrörelserna måste kontrolleras. Mänskliga rättigheter, fredlig konflikthantering och en konfliktförebyggande politik behöver sättas i första rummet för EU:s bistånds- och utrikespolitik. Vi accepterar inte att EU militariseras. EU:s utrikespolitik värnar i alltför stor utsträckning snäva europeiska intressen, och bör i stället inriktas på fattigdomsbekämpning, demo- kratibyggande och miljöarbete. Sverige har i alltför hög grad anpassat sin utrikespolitik till de stora EU-länderna, och den gemensamma utrikespolitik- en får inte bli en ursäkt för en passiv svensk politik i FN:s generalförsamling. Vi arbetar för att motverka EU:s demokratiska brister. I dag bestämmer EU över många områden som unionen inte borde hantera, som skulle hant- eras bättre regionalt, nationellt eller lokalt. Det folkliga inflytandet är alltför begränsat och möjligheterna att utkräva ansvar måste stärkas. Med- borgarna ska garanteras insyn och kunna påverka besluten. Offentlighetsprincip och meddelarfrihet efter svensk modell bör gälla även i EU. Inflytande ska inte avgöras av vilka ekonomiska resurser man har, och därför ska lobbyismen regleras och ekonomiska intressens makt balanseras av aktiva folkrörelser och möjlighet till insyn och påverkan i alla EU:s institutioner. Medlemsländerna måste få rätt att gå före med hårdare lagstiftning till skydd för miljö och hälsa även om det strider mot EU:s inre marknad. Han- delshinder gentemot fattiga länder ska rivas så att handelspolitiken kan bli ett effektivt verktyg för fattiga länder att utveckla sina ekonomier utifrån sina förutsättningar. Samtidigt ska de inte lockas till överexploatering av egna naturresurser. Vi vill införa hårda miljökrav och sociala krav i handelspolitiken som kan bidra till förbättringar långt utanför EU:s gränser. EU:s jordbrukspolitik ska inte bidra till att dumpa priser på marknaderna i utvecklingsländer. EU måste föra en mer aktiv miljöpolitik. Vi ser gärna överstatliga beslut angående miljöskyddande åtgärder så som hantering av gränsöverskridande miljöföroreningar, skydd för hotade arter och biotoper samt minimiregler och -skatter för att stärka miljöskyddet och minska klimatpåverkande utsläpp. EU måste ta sitt ansvar för utvecklingen i världen genom att gå i spetsen för att det ska bli en inter- nationell klimatöverenskommelse som minskar utsläppen av växthusgaser till en nivå som behövs för att stabilisera temperaturökningen på en ickeskadlig nivå. EU-budgeten används ofta ineffektivt och till fel saker. Det är inte rimligt att EU lägger stora resurser på fossil- och kemikalieberoende jordbruk, kärn- kraft och motorvägsbyggen i ekonomiskt starka delar av EU, medan ekologiskt jordbruk, hållbar infrastruktur och förnybar energi får stryka på foten. Budgeten måste utformas så att den inte går till åtgärder som skadar klimatet. Europarådet är det främsta organet för att skydda och utveckla de mänskliga rättigheterna i Europa. EU har varit en mycket positiv kraft för utvecklingen i ansökarländerna, bland annat genom att villkora medlemskapet med reformer. Samtidigt ser vi nu hur diskriminering tilltar mot migranter och minoriteter inom EU, inte minst mot judar, muslimer och romer. EU måste få bättre verktyg att ta itu med brott mot de mänskliga rättigheterna inom unionen, och sanktionssystemet behöver utvecklas. 33 EU:s flyktingpolitik har rest höga murar mot om- världen. Varje år dör människor i försök att ta sig in över unionens yttre gränser. Politiken måste ändras. Vi anser att människor ska få en reell möjlighet att fly till EU och få en seriös prövning av sina asylskäl. Ingen människa är illegal. Det måste skapas fler lagliga vägar för människor att invandra till unionen. Flyktingar ska inte skickas runt inom unionen utan i stället ges en seriös prövning av sina asylskäl där de befinner sig. Den politiska oförmågan att hantera den ekonomiska krisen och växande klyftor, som förvärrats av det ogenomtänkta prestigeprojektet med en gemensam valuta, har under 2010-talet lett till att nya motsättningar växt fram mellan människor och länder i Europa. Utvecklingen är mycket oroande. Vi arbetar kraftfullt mot rasism och fascism. Utifrån vår decentralistiskagrundsynär viettEUkritisktpartiochdärför arbetar viför attförändra unionen.Miljöpartietdegröna motsätter sig en utveckling mot en europeiskfederation.Vi stöder tanken attEU ska utvecklastillett merflexibelt samarbetedär varje medlemslandinom rimliga gränserkan välja vilka delar de villdeltai.Detär samtidigt viktigt attdetinteblir så att engrupp länderbygger uppen egen statsbildning eller mycketlångtgående samarbeteinom EU:s ramar, somipraktikentvingar andraländer attfölja efter.Frågan om EU:sframtidinnebär komplicerade avvägningarochdetärviktigtatt utvecklingen sker med respektför atthelheten ska fungera.Vivill att medlemsländernas egna parlamentskages reell möjlighet attkontrollera attEUintefattarbeslututanför sinabefogenheter. Centralstyrningska minska ochde enskilda ländernasfrihetöka.Sverige ska ståfrittfrån EMUochinteinföra euron.Vi anser att varjeland iEuropa skafågåmediEU omlandet uppfyller grundläggandekravifråga om demokratioch mänskliga rättigheter. ................... ...................... Vi vill värna det unika samarbetet i vårt närområde, mellan de nordiska staterna. Miljöpartiet ska vara starkt pådrivande i att riva ned gränshinder även i Norden, förbättra den skandinaviska språkförståelsen och nationella minoriteters rättigheter samt förbättra den gemensamma arbetsmarknaden. Miljöpartiet ska arbeta för ett ambitiöst och koordinerat klimatarbete i Norden. Detta gör vi genom att sätta den gröna agendan. ............................Ò ......... Många av världens konflikter växer ur fattigdom, brist på demokrati och mänskliga rättigheter samt ur kamp om begränsade naturresurser. Världen omkring oss förändras. Några av de hot som har ökat och tillkommit är klimathot, vatten- och energibrist, terrorism och hot mot IT- och andra kommunikationssystem. När miljömässiga, säkerhetspolitiska och ekonomiska intressen kolliderar behövs nya internationella regelverk. Politiken ska ligga steget före och förhindra att katastrofer inträffar. Samhället förlitar sig i dag i alltför hög grad på en storskalig och högteknologisk infrastruktur som är sårbar för oförutsedda störningar. Därför förordar vi att fler alternativa och lokala lösningar skapas som komplement för ett mer robust samhälle. System som med fördel kan bygga på enkel teknik. Sverige som land och även lokalsamhällena måste bli mer självförsörjande och mindre sårbara. Klimatförändringarna riskerar att slå hårt mot den globala livsmedelsförsörjningen. I det internationella arbetet med att säkerställa globalt tryggad livsmedelsförsörjning ska Sverige vara ledande. Ökande medeltemperatur, mer nederbörd och oftare återkommande extremväder som skyfall och värmeböljor kräver ett arbete med klimatanpassning för att minska samhällets sårbarhet. Det kan bland annat handla om att förebygga och mildra översvämningar. Vi behöver samordna arbetet med klimatanpassningen och satsa resurser för att på allvar sätta igång med arbetet. 34 En varaktigt hållbar fred förutsätter samhällsförhållanden och livsvillkor som allmänt uppfattas somacceptablaochrättvisa.Deberördamänniskornas delaktighet i samhället och i fredsprocessen är därför en viktig framgångsfaktor. Kvinnors deltagande i fredsprocesser, vid fredsförhandlingar och i försoningsarbete är avgörande. Alltför ofta stängs kvinnor ute vilket gör att deras erfarenheter inte tas tillvara, trots att kvinnor och barn blir särskilt utsatta vid väpnad konflikt. Exempel visar att när kvinnor engagerar sig för fred blir denna stabilare och mer långsiktig. Vi vill se en politik som sätter mänsklig säkerhet före territoriell. Fred är inte bara målet utan vägen dit. Mänskligheten har utvecklat mängder av verktyg för att kunna hantera konflikter och bekämpa orättvisor genom ickevåld. Sådana initiativ behöver stödjas och utvecklas, bland annat genom förebyggande diplomati och fredsbyggande insatser av det civila samhällets organisationer. Militära insatser kan dock rättfärdigas då förebyggande åtgärder misslyckats och det är det enda medlet för att förhindra ytterligare kränkningar av de mänskliga rättigheterna och lidande. En förutsättning är att det sker i självförsvar eller med FN-mandat. Miljöpartiet de gröna värnar om den militära alliansfriheten och är därför mot anslutning till NATO. Sverige ska i sin säkerhetspolitik aktivt delta i uppbyggnaden av ett internationellt samarbete i frågor som rör nedrustning, ickevåldsfördrag och demilitariserade zoner. Vi ska också själva ha en beredskap på hemmaplan för att kunna möta de olika slags hot som säkerhetspolitiken identifierar. Vår militära beredskap ska syfta till att kunna genomföra internationella insatser och att bibehålla kunskap om nya hot i framtiden skulle riktas mot Sverige. Deltagande i det militära försvarets verksamheter ska bygga på frivillighet. För att kunna möta hoten mot vårt samhälle måste vi bredda och utveckla den nationella säkerhetspolitiken så att den bättre motsvarar framtidens kriser. Ingen nation kan hota sig till säkerhet eller kriga sig till fred. Sverige ska ta initiativ till inter- nationell nedrustning och bör gå före och nedrusta utifrån aktuella och politiskt förankrade hotbildsbedömningar. Vi ska satsa på att investera i förebyggande och fredsfrämjande insatser, samt aktörer som arbetar med fredlig konflikthantering. Sverige ska bidra till militär nedrustning i världen. Miljöpartiet de grönas mål är därför en avvecklad vapenexport. Uthyrningen av svensk mark till NATO och andra utländska militärstyrkor för krigsövningar ska också upphöra. Export av vapen och annan krigsmateriel till diktaturer, länder som befinner sig i väpnad konflikt eller där grova och omfattande kränkningar av mänskliga rättigheter förekommer ska avskaffas. Vi vill se en avveckling av kärnvapen och andra massförstörelsevapen. Mäns våld mot kvinnor är ett strukturellt och globalt problem. Våldtäkt blir också ett allt vanlig- are vapen i väpnade konflikter. Fredsarbete och internationella insatser måste ha kunskap och resurser att säkerställa kvinnors säkerhet. ..............................4 ........ ......................" Miljöpartiet de gröna sätter folkrätten och de mänskliga rättigheterna i centrum. Inrikes- och utrikespolitik måste vila på samma värdegrund. De rättigheter som vi arbetar för i vår del av världen är universella.Påenendajordmedbegränsaderesurser är vi beroende av varandra och har ett gemensamt ansvar. Det kräver en utjämning och en rätt- vis fördelning av jordens resurser. Fattiga människors ekonomiska, sociala och kulturella rättigheter ska respekteras. Svängningar i världsekonomin drabbar fattiga länders strävanden efter utveckling. Sverige ska därför arbeta för att göra världsekonomin mer robust. Företags skatteflykt ska stoppas. Förutsättningar för handel ska utformas med utjämning av resurser som ledstjärna. Världshandelsorganisationen WTO, Internationella valutafonden IMF och Världsbanken ska reformeras och demokratiseras. Rika länders exportsubventioner, exempelvis av jordbruksprodukter från EU, ska upphöra. 35 Sverige ska ställa krav på att importerade varor är tillverkade med hänsyn till miljö, mänskliga rättig- ........................s heter och arbetsförhållanden för anställda i tillverk ningsländerna. Organisationer som verkar för rätt- vis handel och för att utveckla kontrollsystem som understödjer detta ska stödjas. Miljöpartiet ser en fri och oövervakad tillgång till internet som ett viktigt medel för att stärka människors egenmakt i alla länder. Miljöpartiet de gröna verkar för en solidarisk utvecklingspolitik. Det betyder att vi vill att utvecklingssamarbete och skuldavskrivningar ska präglas av respekt och lyhördhet för mottagarländernas behov. Ländernas och lokalsamhällenas egen kultur och demokratiskt fattade beslut måste ligga till grund för utvecklingen, inte givarlandets behov av att gynna sin egen exportindustri. I många fall är solidariskt bistånd mellan folk och icke-statliga organisationer effektivare än stöd direkt till regeringar. Organisationer som arbetar för demokrati, mänskliga rättigheter, jämställdhet och hållbar utveckling bör ges stöd genom svenskt utvecklingssamarbete. Sverigesutvecklingspolitikskavarasamstämmig. MeddetmenarviattSverige intekangestödtill miljöförstörandeverksamhetersamtidigtsomvi verkarförenhållbarutveckling.Sveriges insatserför fredär intehellertrovärdiganärvisamtidigt exporterarvapentilldiktaturerochländer i fattigdom.Måletomenrättvisochhållbarglobal utvecklingmåstegåförekortsiktigaekonomiska intressen.Starkamyndigheterochinstitutionerär nödvändigaförattutvecklingskafåfart.Därförkan bistånddirekttillstatersbudgetarvaradetbästa sättetattstödjautvecklingenförfattigamänniskor. Sverige är globalt sett ett mycket rikt land. Därför är det rimligt att minst en procent av Sveriges bruttonationalinkomst, BNI, avsätts till internationellt bistånd. Därutöver ska Sverige bidra med kraftfulla klimatinsatser för att betala den ”klimatskuld” som Sverige med sina stora historiska utsläpp av växthusgaser har skapat. Miljöpartiet de gröna har en vision om en värld utan gränser, där alla människor kan flytta, och ingen tvingas fly. Vi tror inte på länders rätt att välja sina invånare, vi tror på människors rätt att välja var de vill bo. Vi ska möta människor med möjligheter, inte murar. Alla ska kunna leva, arbeta och förverkliga sina drömmar där de önskar. Fri rörlighet borde vara en mänsklig rättighet. Människorhar alltidochkommer alltid att rörapå sig.En delåker utomlandsför attstudera eller arbeta, andraför attdeharfunnitkärleken.Vissa flyttartillbaka,andrainte.Oftaärflytteninte frivilligutanenföljd avkonflikt,förföljelseeller andra omständigheter somhargjortdet omöjligt för en attbokvarisitthem.Redanidagser vihur klimatförändringarnatvingar människor attflypå grundavextremtorka,översvämningaroch oväder. I en allt mer globaliserad värld är människans rörelsemönster mer komplicerat än någonsin. Allt oftare flyttar människor inte enbart från sitt hemland till ett annat land, utan också fram och tillbaka mellan länder. Cirkulär migration har flera positiva effekter för individ, samhälle och ekonomi, men ställer också ökade krav på stater att bättre underlätta migrationsprocesser. Vi vill att Sverige ska vara ett land som är öppet för arbetskraftsinvandring. Möjligheten att kunna söka sig till ett annat land för att arbeta är en grundläggande frihet och en vinst för både avsändar- och mottagarlandet. Ett öppet regelverk ställer samtidigt krav på nationella regleringar och internationella samarbeten för att motverka diskriminering, dåliga arbetsvillkor och oseriösa arbetsgivare. Människor som arbetskraftsinvandrar ska ha lika goda förutsättningar på arbetsmarknaden som andra personer i Sverige. När ansökningar om uppehållstillståndbehandlas ska anknytning ochhälsa vägatyngreän detgör i dag.Detbehöverblienklare att söka uppehållstillstånddirektifrånSverige, iställetförattmänniskor skatvingasåkatillbakatilldetgamlahem 36 landet,vilketkan varaförenat medlivsfara. Sverigeskavaraenfristadfrånförföljelse, tortyr ochkrig. Medmänsklighet och solidaritet är universellt. Alla ska omfattas av de mänskliga rättigheterna och flyktingar ska garanteras en rättssäker asylprocess i Sverige. Den som får avslag på sin asylansökan ska inte hållas i förvar, utan i första hand få hjälp att frivilligt återvända till sitt hemland. Tvångsavvisningar ska användas oerhört restriktivt. Människor som kommer till Sverige ska snabbt få kontakt med skola, vård och arbetsmarknad. Tidigare erfarenheter, vare sig det är utländsk utbildning, arbetslivserfarenhet eller språkkunskaper, ska också kunna tillgodoräknas i Sverige. Staten och kommunerna har ett gemensamt ansvar för att människor som kommer till Sverige ska få en bra start i landet. Alla kommuner ska ha ett gene- röst och likvärdigt flyktingmottagande. Livet som papperslös i Sverige är kantat av rädsla, oro och osäkerhet inför framtiden. Många människor lever sina liv utan tillgång till grundläggande samhällsfunktioner, rättigheter och tryggheter. Livet som papperslös i Sverige får aldrig vara ett liv som rättslös. Sverigepräglasidagavenrasismsomiförsta handskadar marginaliserade samhällsgrupper. I längdenfallerdockalla offerförbegränsande fördomar, stereotyper och normer.Främlingsfientlighetochrasismär oförenligt med ett samhälledär allafårleva och verkapålika villkor. Arbetetmotfysiskagränsergårhandihandmed arbetet motde socialagränserna sombegränsar människorsfrihet. Vi är stolta över att vara det mest öppna partiet när det gäller migration. I ett Europa där främlingsfientliga krafter når nya framgångar vill vi att Sverige ska gå före i arbetet för en värld utan gränser. Vi vill ha ett samhälle där ingen tvingas leva som papperslös, ett Sverige där ingen familj är splittrad, och en värld där alla kan röra sig fritt. Miljöpartiet de gröna vill att alla människor ska välkomnas i ett samhällsbygge med öppenhet, solidaritet och medmänsklighet som grund. Att vi är öppna för omvärlden och alla människors olikheter är en förutsättning för det gröna samhäll- et. Vi är övertygade om att ett nytt Sverige är möjligt. Ett Sverige där det är vår gemensamma framtid som förenar oss, snarare än etnicitet, födelseort eller religiös tillhörighet. 37 ............................" Vi i Miljöpartiet de gröna har tagit på oss dubbla roller. Vi är både stigfinnare och ett politiskt parti i traditionell mening. Vi är både före vår tid och mitt i den. Det är en stor utmaning. Vi får inte vara så långt före att vi tappar kontakten med dem som kommer efter, stigen får inte växa igen. Samtidigtvetviattingentidfinnsattförlora.Vivågar varastegetföre.Viärstigfinnarnaisvenskpolitik– ettalternativförframtidstroochlivsbejakelse. Världen är full av komplexa samband och ömsesidiga beroenden. Att tro att vi begriper hela vår värld vore naivt. Därför ska vi inte betrakta oss som naturens härskare. Vi kan inte veta hur mycket eller hur lite vi har förstått. Vi hämtar vår kraft i en insikt om att varje enskild handling påverkar vår omvärld och framtid. Det ger oss stora möjligheter, men även ett stort ansvar. Att inte respektera naturens villkor drabbar i längden alla jordens invånare – även oss själva. Det krävs kunskap, tålamod och envishet för att rubba ingrodda tankemönster. Tiden för eftertanke får inte drunkna i en ocean av ytlig information. Den gröna vägen handlar inte om ”vi och dom”. Den handlar inte heller om egoism. Den handlar om att se till helheten. Därför söker vi samarbete och förståelse för att förverkliga vår gröna vision. Miljöpartiet de gröna är inget självändamål, utan den gröna rörelsens parlamentariska gren. Prestige får inte hindra oss från att förutsättningslöst stanna upp, reflektera och ifrågasätta även våra egna idéer, strukturer och metoder. Det myllrar av liv under varje liten sten på vår planet. Vi är en del av något oändligt mycket större. Denna insikt frammanar ödmjukhet, men också handling. Kanske är det just när vi själva förmår njuta av livet och naturen som vi påminns om vad det är vi kämpar för. Omtänksamma och engagerade människor förändrar världen. Varje utveckling tar sin början i den enskilda människans övertygelse och engagemang. Du gör skillnad! 38 39 www.mp.se